Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Atopic dermatitis 952 1.2e-04
osteosarcoma 7950 1.3e-04
group 3 medulloblastoma 4104 7.0e-04
Disease Target Count Z-score Confidence
Myofibroma 1 5.298 2.6

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis 1.100 1.2e-04
group 3 medulloblastoma 1.600 7.0e-04
osteosarcoma -1.292 1.3e-04

AA Sequence

MHYIKTWSLLGEMSEKLRRCRKELTAAIDRAFEGVSYSQECTGQQRLELSAAPLSFSLPVHRLLCRRHPL      1 - 70
AACSSAAPFAAVPCAPENENPAFATNHAPVNAKPHALCPERKPLTSKENVLMHSSILAPERESWRTAGEG     71 - 140
ENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMIDHTSIRTIEELAGKIEFENELNHMCGHCQDS    141 - 210
PFKEEAWALLMDKSPQKATDADPGSLKQAFDDHNIVETVLDLEEDYNVMTSFKYQIE                 211 - 267
//

Text Mined References (5)

PMID Year Title