Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.36
PubTator Score 7.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Autistic Disorder 364 3.598 1.8
Autism spectrum disorder 101 0.0 0.0
Disease Target Count
Autism Spectrum Disorders 75
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 6.1e-03
Breast cancer -1.300 4.5e-04
juvenile dermatomyositis 1.084 1.1e-09
osteosarcoma 1.144 3.6e-03
ovarian cancer -1.400 1.8e-03
pancreatic ductal adenocarcinoma liver m... -1.427 9.1e-03

Gene RIF (2)

AA Sequence

MWRLVPPKLGRLSRSLKLAALGSLLVLMVLHSPSLLASWQRNELTDRRFLQLNKCPACFGTSWCRRFLNG      1 - 70
QVVFEAWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPRCDLLQA     71 - 140
MPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSGSFLLRNLKDSERMQLLLTLA    141 - 210
FNPEPLVLQSFPSDEGWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFE    211 - 280
FALYLLDVSFDNFAVGPRDGKVIIVDAENVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEIL    281 - 350
CARATVDHNYYAVCQNLLSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECANPKKRYGRFQAAKELRE    351 - 420
YLAQLSNNVR                                                                421 - 430
//

Text Mined References (14)

PMID Year Title