Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.49
PubTator Score 7.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.144 3.6e-03
juvenile dermatomyositis 1.084 1.1e-09
primary pancreatic ductal adenocarcinoma 1.574 9.4e-04
adult high grade glioma -1.100 6.1e-03
Breast cancer -1.300 4.5e-04
ovarian cancer -1.400 1.8e-03

Gene RIF (1)

PMID Text
21264219 results support a model where the DIA1 and DIA1R regulate molecular traffic through the cellular secretory pathway or affect the function of secreted factors, and functional deficits cause disorders with ASD-like symptoms and/or mental retardation

AA Sequence

MWRLVPPKLGRLSRSLKLAALGSLLVLMVLHSPSLLASWQRNELTDRRFLQLNKCPACFGTSWCRRFLNG      1 - 70
QVVFEAWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPRCDLLQA     71 - 140
MPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSGSFLLRNLKDSERMQLLLTLA    141 - 210
FNPEPLVLQSFPSDEGWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFE    211 - 280
FALYLLDVSFDNFAVGPRDGKVIIVDAENVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEIL    281 - 350
CARATVDHNYYAVCQNLLSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECANPKKRYGRFQAAKELRE    351 - 420
YLAQLSNNVR                                                                421 - 430
//

Text Mined References (13)

PMID Year Title
24269490 2014 HASF is a stem cell paracrine factor that activates PKC epsilon mediated cytoprotection.
23784961 2013 C3orf58, a novel paracrine protein, stimulates cardiomyocyte cell-cycle progression through the PI3K-AKT-CDK7 pathway.
21283809 2011 Characterization of the deleted in autism 1 protein family: implications for studying cognitive disorders.
21264219 2011 DIA1R is an X-linked gene related to Deleted In Autism-1.
18651652 2008 Expression of the novel Golgi protein GoPro49 is developmentally regulated during mesenchymal differentiation.
18621663 2008 Identifying autism loci and genes by tracing recent shared ancestry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.