Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.95
PubTator Score 1.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.300 2.6e-08
astrocytoma 1.500 2.0e-24
ependymoma 1.900 9.6e-03
oligodendroglioma 1.900 6.5e-03
psoriasis -1.600 1.4e-09
cutaneous lupus erythematosus -1.100 1.6e-03
glioblastoma 1.300 5.2e-05
osteosarcoma -2.612 1.7e-08
group 3 medulloblastoma 2.300 1.2e-03
atypical teratoid / rhabdoid tumor 1.400 1.7e-03
primitive neuroectodermal tumor 2.100 1.1e-04
cystic fibrosis -1.400 2.1e-04
pediatric high grade glioma 1.100 4.1e-03
pilocytic astrocytoma 1.100 2.7e-03
inflammatory breast cancer -1.100 1.5e-05
Pick disease 1.400 2.6e-04
ovarian cancer -1.600 1.8e-07

Synonym

Accession Q2NKX9 B4DT10 Q4G0J7 Q6ZVA6
Symbols HCRCN81

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
26607374 hcrcn81 might promote carcinogenesis and progression through regulation of the Wnt/beta-catenin signaling pathway and plays an important role in the carcinogenesis of colorectal cancer.
25023051 c2orf68 expression correlates with the pathogenesis of colorectal cancer through PI3K/Akt/mTOR pathway.
23404111 Observations of the current study indicate that hcrcn81 may play a role in tumorigenesis by regulating the mTOR signaling pathway.
21874238 The mRNA levels of NM_001013649.3 are significantly down-regulated in colorectal adenocarcinoma tissue, and this down-regulation is most likely correlated with the differentiation status of the cancer.

AA Sequence

MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVY      1 - 70
LPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAH     71 - 140
TPLDPPMREALKLRIQEEIAKRQSQH                                                141 - 166
//

Text Mined References (8)

PMID Year Title
26607374 2016 hcrcn81 promotes cell proliferation through Wnt signaling pathway in colorectal cancer.
25023051 2014 The role of c2orf68 and PI3K/Akt/mTOR pathway in human colorectal cancer.
23404111 2013 Hcrcn81 is upregulated by rapamycin treatment in human colorectal adenocarcinoma cells.
21874238 NM_001013649.3 gene is down-regulated in human colorectal adenocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.