Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.281 1.9e-03
atypical teratoid / rhabdoid tumor -1.700 8.4e-05
glioblastoma -1.700 5.9e-05
invasive ductal carcinoma -1.100 1.5e-02
osteosarcoma -1.519 2.5e-04
pediatric high grade glioma -1.200 5.3e-05

 Compartment GO Term (1)

AA Sequence

MCRCSLVLLSVDHEVPFSSFFIGWRTEGRAWRAGRPDMADGSGWQPPRPCEAYRAEWKLCRSARHFLHHY      1 - 70
YVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEK     71 - 140
DE                                                                        141 - 142
//

Text Mined References (7)

PMID Year Title