Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.7e-06
Disease Target Count Z-score Confidence
Congestive heart failure 113 0.0 0.9

Expression

AA Sequence

MCTVDVEGFDDVGETLSDAVRDGLGTILRGGAEEGSYDNWPHTRKSWGPLSPGHQRELWTQPDPWTEVLS      1 - 70
GHKGDAGACGCCCFCSQFINARCAHPLCLARGLDRRASEEMPILQALCLLPKVSTRSITVPSPQRSAPRA     71 - 140
SLCPPHKGKSP                                                               141 - 151
//

Text Mined References (9)

PMID Year Title