Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.0e-29
osteosarcoma 7933 4.8e-08
Disease Target Count Z-score Confidence
Chromophobe adenocarcinoma 8 4.41 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.966 4.8e-08
psoriasis -1.300 1.0e-29

Synonym

Accession Q17RA5
Symbols C21orf49

 Compartment GO Term (1)

AA Sequence

MHHVRQLMMPICPMALNSTTSSSTTFGAFRIMTLNVEEWATAWKVLILLEAAVEEEKRSEEKRILVCGTC      1 - 70
GTRSSQKNL                                                                  71 - 79
//

Text Mined References (7)

PMID Year Title
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
7782076 1995 Characterization of a large population of mRNAs from human testis.