Property Summary

NCBI Gene PubMed Count 4
PubMed Score 71.74
PubTator Score 57.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.100 9.3e-06
osteosarcoma -1.398 1.3e-05
posterior fossa group B ependymoma 1.800 7.2e-12
group 3 medulloblastoma 1.900 7.3e-05
atypical teratoid / rhabdoid tumor 1.500 1.0e-06
glioblastoma 1.300 6.0e-05
medulloblastoma, large-cell 1.400 2.0e-04
primitive neuroectodermal tumor 1.400 3.0e-04
Breast cancer 2.600 2.4e-02
spina bifida -2.211 2.3e-02
ductal carcinoma in situ 1.600 6.6e-04
invasive ductal carcinoma 1.500 1.2e-02

Synonym

Accession Q9BUN1 B2RDU8 Q9NWZ4
Symbols MENT

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
24094886 DNMT3B7 overexpression might interfere with the normal DNA methylation mechanism required for silencing the MENT proto-oncogene, and may accelerate human lymphomagenesis.

AA Sequence

MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKTRIILEDENDA      1 - 70
MADADRLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDSTSRELPSATPNTAGSSSTRFI     71 - 140
ANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGSTPSRWPSPSPTAMPSPEDLRLVLMPWGPWH    141 - 210
CHCKSGTMSRSRSGKLHGLSGRLRVGALSQLRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTT    211 - 280
STRTTTTPFPTIHLRSSPSLPPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR             281 - 341
//

Text Mined References (7)

PMID Year Title
24094886 2013 DNMT3B7 expression related to MENT expression and its promoter methylation in human lymphomas.
22133874 2012 Loss of Dnmt3b function upregulates the tumor modifier Ment and accelerates mouse lymphomagenesis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.