Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.20
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4559 4.2e-10
osteosarcoma 7766 2.4e-09
acute quadriplegic myopathy 1133 3.5e-08
primitive neuroectodermal tumor 2957 1.9e-04
ovarian cancer 8297 6.8e-04
breast carcinoma 1589 1.4e-03
lung cancer 4607 5.8e-03
glioblastoma 5635 8.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
primary open angle glaucoma 16 3.331 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.178 3.5e-08
breast carcinoma 1.500 1.4e-03
ependymoma 1.200 4.2e-10
glioblastoma 1.100 8.9e-03
lung cancer 1.100 5.8e-03
osteosarcoma -2.420 2.4e-09
ovarian cancer 1.200 6.8e-04
primitive neuroectodermal tumor 1.100 1.9e-04

Gene RIF (1)

AA Sequence

MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHPKAKLDNLDEE      1 - 70
WATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSINRKRLWNFTEEEVSERVTLHI     71 - 140
CASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTR    141 - 210
WAKEIENGVYLINGQVKDEDCDLLEGQKKSSRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVN    211 - 280
LKGAVKCRAYIHSSKPKVKDAVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPL    281 - 350
PGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI    351 - 420
KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD                                        421 - 454
//

Text Mined References (11)

PMID Year Title