Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.8e-10
posterior fossa group B ependymoma 1530 4.4e-05
pituitary cancer 1972 8.3e-05
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 4.4e-05
ovarian cancer -1.200 1.8e-10
pituitary cancer 1.100 8.3e-05

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

LFVLMLLFFTILVLSYFRYMRIYRRYIYEPLHKPQRKRKKN                                 911 - 951

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.