Property Summary

Ligand Count 15
NCBI Gene PubMed Count 47
PubMed Score 314.95
PubTator Score 219.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
cystic fibrosis 1696
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Ehlers-Danlos syndrome 43 0.0 4.0

Expression

  Differential Expression (33)

Disease log2 FC p
acute quadriplegic myopathy 1.211 9.9e-04
adrenocortical carcinoma -1.196 5.0e-02
adult high grade glioma 1.800 1.6e-03
Astrocytoma, Pilocytic 3.000 1.2e-11
Becker muscular dystrophy 1.207 9.8e-04
colon cancer -1.300 1.5e-02
cystic fibrosis 1.400 1.2e-02
dermatomyositis 1.600 1.6e-03
diabetes mellitus -1.600 4.1e-03
Duchenne muscular dystrophy 1.942 5.7e-10
ependymoma 1.900 8.7e-05
facioscapulohumeral dystrophy -1.600 1.4e-02
gastric carcinoma 1.900 6.3e-03
glioblastoma 1.500 7.8e-04
interstitial cystitis 1.100 5.2e-03
intraductal papillary-mucinous adenoma (... -2.100 2.1e-04
intraductal papillary-mucinous carcinoma... -2.800 4.3e-05
intraductal papillary-mucinous neoplasm ... -2.900 1.4e-03
invasive ductal carcinoma -1.500 1.2e-03
juvenile dermatomyositis 2.216 4.3e-14
limb girdle muscular dystrophy 2A 1.493 4.9e-07
lung cancer -1.700 3.7e-05
lung carcinoma -2.700 5.9e-27
malignant mesothelioma -4.400 2.8e-09
medulloblastoma, large-cell -1.500 4.9e-03
ovarian cancer -2.800 1.1e-07
pancreatic cancer 2.300 6.6e-05
pituitary cancer -2.900 1.3e-08
primary pancreatic ductal adenocarcinoma 2.102 1.4e-04
primary Sjogren syndrome 1.200 3.2e-02
sonic hedgehog group medulloblastoma 1.200 1.1e-02
subependymal giant cell astrocytoma 2.479 8.1e-03
ulcerative colitis 2.500 3.9e-06

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEG      1 - 70
CFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQA     71 - 140
VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEY    141 - 210
PRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSS    211 - 280
NAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQV    281 - 350
LHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR    351 - 420
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGA    421 - 490
LLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIAL    491 - 560
LELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRM    561 - 630
DVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKE    631 - 700
MEEED                                                                     701 - 705
//

Text Mined References (53)

PMID Year Title