Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.10
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.7e-24
non-small cell lung cancer 2890 4.6e-12
invasive ductal carcinoma 2951 9.6e-03
ductal carcinoma in situ 1745 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
ductal carcinoma in situ -1.300 4.2e-02
invasive ductal carcinoma -1.800 9.6e-03
non-small cell lung cancer -1.240 4.6e-12
psoriasis -1.100 5.7e-24

AA Sequence

MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDG      1 - 70
HDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGP     71 - 140
CSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAI    141 - 210
GLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQD    211 - 280
DPNEV                                                                     281 - 285
//

Text Mined References (6)

PMID Year Title