Property Summary

NCBI Gene PubMed Count 110
PubMed Score 50.26
PubTator Score 2440.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lupus erythematosus 80 3.906 2.0
Disease Target Count
Complement component C1q deficiency 3

Expression

 OMIM Phenotype (1)

Gene RIF (90)

PMID Text
26831747 These findings support a role for locally synthesized C1q in promoting tumor growth.
26829984 anti-C1q induced a proinflammatory phenotype in human monocyte-derived macrophages reversing the effects of immobilized C1q alone
26563161 decreased levels result in predominant skin manifestations in children
26095468 The A allele and AA genotype of C1q rs292001 can be considered a susceptibility risk factor and the GG genotype could be considered protective for juvenile systemic lupus erythematosus and lupus nephritis in the studied cohort of Egyptian children.
25817358 no significant association found to either rs15940 (C1QA) or rs172378 (C1QC) when analysed in just Parkinson disease cases , just controls or combined
25491308 Elevation in serum C1q levels are associated with sarcopenia.
25487697 This study reveled that C1QA having a central role in the bipolar disease and schizophrenia manifestation.
25184227 Our findings showed that Brugia malayi Calreticulin (BmCRT) is responsible for the prevention of classical complement pathway activation via its interaction with the first component C1q of the human host
24747831 A newly characterized leech calreticulin (HmCalR) has been shown to interact with C1q and participate to the HmC1q-dependent microglia accumulation.
24739385 PepO facilitates C1q-mediated bacterial adherence, whereas its localized release consumes complement as a result of its activation following binding of C1q, thus representing an additional mechanism of human complement escape by this versatile pathogen.
24647646 C1q expression correlates with active disease in human tuberculosis.
24591625 C1q was found to induce permeability of the endothelial cell monolayer, to stimulate EC proliferation and migration, and to promote tube formation and sprouting of new vessels in a rat aortic ring assay.
24557008 interaction with calreticulin controls the phagocyte inflammatory status
24395916 Both CERT isoforms, when immobilized, were found to bind the globular head region of C1q and to initiate the classical complement pathway. C1q binds endogenous CERTL on the surface of apoptotic cells.
24331529 mutations are associated with development of lupus
24053688 Data indicate that complement C1q (C1q) deposition in kidney was comparable between patients with and without serum anti-C1q antibodies.
23991234 Most likely, C1q bridges calreticulin on the parasite surface with its receptor orthologue on human placental cells, thus facilitating the first encounter between the parasite and the fetal derived placental tissue.
23720782 Data indicate that Cna binds to C1q.
23650384 Analysis of its interaction properties by surface plasmon resonance shows that rC1q retains the ability of serum C1q to associate with the C1s-C1r-C1r-C1s tetramer, to recognize physiological C1q ligands such as IgG and pentraxin 3
23607884 Single nucleotide polymorphisms in and around the C1q genes, C1qA, C1qB and C1qC, correlated with C1q serum levels and may be a risk for the development of rheumatoid arthritis.
23086952 The ability of C1q to sense both human and bacterial GAPDHs sheds new insights on the role of this important defense collagen molecule in modulating the immune response.
22879587 Annexin A2 and A5 serve as new ligands for C1q on apoptotic cells
22740328 We identified a major linear epitope of C1q that is the target of anti-C1q in systemic lupus erythematosis.
22700724 C1q/gC1qR may regulate dendritic cells differentiation and function through the DC-SIGN-mediated induction of cell-signaling pathways.
22472776 identification of a new mutation in C1qA that disrupts the start codon (ATG to AGG (Met1Arg)) expands the knowledge and importance of the C1q gene in the pathogenesis of lupus, especially in the high-risk African-American population
22356764 This study demonstrated that rHmC1q-dependent chemotaxis might be driven via a HmC1q-binding protein located on the microglial cell surfac.
22260551 C1qA can counteract the function of the C1q receptor gC1qR in RIG-I-mediated signalling
22236909 The C1qA SNPs, rs172378 and rs665691, confer no genetic predisposition to systemic lupus erythematosus in a Chinese Han population
21968398 A genetic association of the TRAF1/C5, C1q, and eNOS gene polymorphism, but not of STAT4 and PTPN22, was found to confer a degree of risk for systemic lupus erythematosus in the Turkish population.
21951915 There was no association between C1QA rs292001 genetic variants and schizophrenia when compared to healthy subjects.
21862594 analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages
21429584 C1q may induce tolerogenic properties in developing dendritic cells.
21343881 we present evidence suggesting that microglia are capable of phagocytosing and clearing cellular debris of degenerating neurons from the substantia nigra pars compacta through a C1q-mediated pathway
21256764 Data show that the C1q binding assay could discriminate between different levels of aggregates where ACA had reached a plateau.
21159384 The presence of anti-globular head fragment in both healthy and diseased humans also implies that these antibodies, unlike anti-collagen-like region, may have a contribution to an onset of autoimmunity.
21134100 Results suggest a novel mechanism for pathogen entry into host cells as well as a new function for C1q- alpha2beta1 integrin interactions.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20560256 A 29-month-old boy presented with facial rash and history of early death of a sibling with infections, was found to have a selective deficiency of C1q with a homozygous point mutation in the C1qA gene cahin.
20528885 In a large family-based association study of C1Q gene cluster polymorphisms no evidence for a genetic role of C1Q locus SNP in systemic lupus erythematosus risk predisposition was obtained in patients of European ancestry.
20528885 Observational study of gene-disease association. (HuGE Navigator)
20496011 reduced levels of the expression of C1q by dendritic cells and macrophages in the esophagus may play a role in the formation of immune responses associated with the formation of specialized intestinal metaplasia and the development of adenocarcinoma.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20332777 rs172378 is linked to a regulatory element affecting gene expression and that allelic preferential expression is altered in tumour samples, but do not support an association between genetic variation in C1QA and breast cancer survival.
20332777 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20139276 Data show that C1q, C4, C3, and C9 bind to thrombin receptor-activating peptide-activated platelets in lepirudin-anticoagulated platelet-rich plasma (PRP) and whole blood.
20008834 Analysis of human C1q by combined bottom-up and top-down mass spectrometry.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896716 These findings suggest coat protein inhibits C1 and MBL activation via a novel mechanism of interference with the normal interaction of the recognition molecule with its cognate serine proteases.
19656971 M1 blocked the interaction between C1qA and heat-aggregated IgG in vitro and inhibited haemolysis.
19493541 C1QA (rs172378)correlates with earlier age of onset in TTR Val30Met familial amyloidotic polyneuropathy.
19493541 Observational study of gene-disease association. (HuGE Navigator)
19484134 Downregulation of C1q enhances prostate hyperplasia and cancerous formation due to failure of WOX1 activation
19440201 The C1QA gene is associated with subphenotypes of lupus in the African-American and Hispanic subjects.
19423540 Observational study of gene-disease association. (HuGE Navigator)
18927313 polymorphism in the complement component C1qA correlates with prolonged response following rituximab therapy of follicular lymphoma.
18927313 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18505047 Observational study of gene-disease association. (HuGE Navigator)
18504288 Observational study of gene-disease association. (HuGE Navigator)
18406463 various conformational isoforms (native, amyloid fibrils, and beta-oligomers) of recombinant human PrP (90-231 and 121-231) bind C1q and activate complement.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18054386 The dominant types of C1q complexes that circulate in vivo are C1q-C3d and C1q-C4d complexes.
17929239 Betulin disulphate (B2S) and 9,9-bis(4'-hydroxyphenyl)fluorene disulphate (F2S) inhibit the interaction of C1q and its recombinant globular modules with target molecules IgG1, C-reactive protein (CRP) and long pentraxin 3 (PTX3).
16566583 results suggest that charged residues belonging to the apex of the gC1q heterotrimer (with participation of all three chains) as well as the side of the ghB are crucial for C1q binding to ligands, IgG1, C-reactive protein, and pentraxin 3
16465510 Observational study of gene-disease association. (HuGE Navigator)
16465510 These results suggest there could be an association of a single nucleotide polymorphism at position 276 of the C1qA component of complement with breast cancer metastasis to sites linked to hematogenous spread of disease.
16046396 fibromodulin activates the classical pathway of complement by directly binding C1q
15878871 analysis of C-reactive protein binding to FcgammaRI, FcgammaRIIa, and C1q
15034050 Complementary interacting sites on the C1q globular domain have been precisely defined. Characterization of point mutants suggests a complementary role for Arg162 of the C1q A chain in the C1q-IgG interaction.
12960167 The structure refined to 1.9 A of resolution of C1q reveals the conformation of subunits A, B, and C and their compact, almost spherical heterotrimeric assembly held together mainly by non-polar interactions, with a Ca2+ ion bound at the top.
12847249 The C-terminal globular region of the C1Q A chain may have evolved as a functionally specialized domain or module with distinct binding properties which together with the B and C chains confers versatility and flexibility to the whole C1q molecule.
12645945 Experiments with recombinant globular head domains of human C1q A, B, and C chains indicated that C1q interacts with PTX3 via its globular head region. Binding of C1q to immobilized PTX3 induced activation of the classical complement pathway.
12630757 Observational study of gene-disease association. (HuGE Navigator)
12630757 We report an association between subacute cutaneous lupus erythematosus (SCLE) and a new single nucleotide polymorphism (SNP) in the C1QA gene. We also describe an association between this SNP and lower levels of serum C1q.
12396016 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
11318594 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
10504397 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
9780209 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
9444979 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
9443108 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
9223728 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
9052718 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
8252810 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
8245486 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7739575 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7642209 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7507842 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
1875953 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
1744579 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese

AA Sequence

MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQ      1 - 70
GEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQ     71 - 140
EEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQ    141 - 210
QGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA                                       211 - 245
//

Text Mined References (112)

PMID Year Title
27648858 2016 The production and secretion of complement component C1q by human mast cells.
27333900 2016 Complement is activated in progressive multiple sclerosis cortical grey matter lesions.
27267200 2016 Transcriptome analysis of human brain tissue identifies reduced expression of complement complex C1Q Genes in Rett syndrome.
26831747 2016 C1q acts in the tumour microenvironment as a cancer-promoting factor independently of complement activation.
26829984 2016 Anti-C1q Autoantibodies from Systemic Lupus Erythematosus Patients Induce a Proinflammatory Phenotype in Macrophages.
26563161 2015 Early Complement Component Deficiency in a Single-Centre Cohort of Pediatric Onset Lupus.
26410546 2015 Fundamental role of C1q in autoimmunity and inflammation.
26175731 2015 Emerging and Novel Functions of Complement Protein C1q.
26095468 2015 C1q rs292001 polymorphism and C1q antibodies in juvenile lupus and their relation to lupus nephritis.
25817358 2015 Variation in complement protein C1q is not a major contributor to cognitive impairment in Parkinson's disease.
25491308 2015 Serum C1q as a novel biomarker of sarcopenia in older adults.
25487697 2015 Innate immune response is differentially dysregulated between bipolar disease and schizophrenia.
25184227 2014 In silico and in vitro studies on the protein-protein interactions between Brugia malayi immunomodulatory protein calreticulin and human C1q.
24747831 2014 Calreticulin contributes to C1q-dependent recruitment of microglia in the leech Hirudo medicinalis following a CNS injury.
24739385 2014 Binding of Streptococcus pneumoniae endopeptidase O (PepO) to complement component C1q modulates the complement attack and promotes host cell adherence.
24647646 2014 Increased complement C1q level marks active disease in human tuberculosis.
24591625 2014 C1q as a unique player in angiogenesis with therapeutic implication in wound healing.
24557008 2014 Relative contribution of c1q and apoptotic cell-surface calreticulin to macrophage phagocytosis.
24395916 2014 Complement activation by ceramide transporter proteins.
24331529 2014 New C1q mutation in a Tunisian family.
24053688 2013 Glomerular C1q deposition and serum anti-C1q antibodies in anti-glomerular basement membrane disease.
23991234 2013 The interaction of classical complement component C1 with parasite and host calreticulin mediates Trypanosoma cruzi infection of human placenta.
23720782 2013 Collagen-binding microbial surface components recognizing adhesive matrix molecule (MSCRAMM) of Gram-positive bacteria inhibit complement activation via the classical pathway.
23650384 2013 Expression of recombinant human complement C1q allows identification of the C1r/C1s-binding sites.
23607884 2013 Genetic variants in the region of the C1q genes are associated with rheumatoid arthritis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23086952 2012 Human and pneumococcal cell surface glyceraldehyde-3-phosphate dehydrogenase (GAPDH) proteins are both ligands of human C1q protein.
22879587 2012 Annexin A2 and A5 serve as new ligands for C1q on apoptotic cells.
22740328 2012 Identification of a major linear C1q epitope allows detection of systemic lupus erythematosus anti-C1q antibodies by a specific peptide-based enzyme-linked immunosorbent assay.
22700724 2012 DC-SIGN, C1q, and gC1qR form a trimolecular receptor complex on the surface of monocyte-derived immature dendritic cells.
22472776 2012 Identification of novel coding mutation in C1qA gene in an African-American pedigree with lupus and C1q deficiency.
22356764 2012 Interaction of HmC1q with leech microglial cells: involvement of C1qBP-related molecule in the induction of cell chemotaxis.
22260551 2012 The complement C1qA enhances retinoic acid-inducible gene-I-mediated immune signalling.
22236909 2012 Association study of C1qA polymorphisms with systemic lupus erythematosus in a Han population.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21968398 2011 TRAF1/C5, eNOS, C1q, but not STAT4 and PTPN22 gene polymorphisms are associated with genetic susceptibility to systemic lupus erythematosus in Turkey.
21951915 2011 Association of C1QB gene polymorphism with schizophrenia in Armenian population.
21862594 2011 Molecular mechanisms for synchronized transcription of three complement C1q subunit genes in dendritic cells and macrophages.
21429584 2011 C1q regulation of dendritic cell development from monocytes with distinct cytokine production and T cell stimulation.
21343881 2011 Possible involvement of complement factor C1q in the clearance of extracellular neuromelanin from the substantia nigra in Parkinson disease.
21256764 2011 C1q aggregate binding for the determination of anti-complementary activity of immunoglobulin products.
21159384 2011 New insight into the autoimmunogenicity of the complement protein C1q.
21134100 2011 Entry of Bacillus anthracis spores into epithelial cells is mediated by the spore surface protein BclA, integrin ?2?1 and complement component C1q.
21054788 2010 CD91 interacts with mannan-binding lectin (MBL) through the MBL-associated serine protease-binding site.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20560256 Hereditary C1q deficiency: a new family with C1qA deficiency.
20528885 2010 Assessing association of common variation in the C1Q gene cluster with systemic lupus erythematosus.
20496011 2010 Expression of C1q complement component in Barrett's esophagus and esophageal adenocarcinoma.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20332777 2010 Common germ-line polymorphism of C1QA and breast cancer survival.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20139276 2010 Complement component C3 binds to activated normal platelets without preceding proteolytic activation and promotes binding to complement receptor 1.
20008834 2010 Analysis of human C1q by combined bottom-up and top-down mass spectrometry: detailed mapping of post-translational modifications and insights into the C1r/C1s binding sites.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896716 2010 Human astrovirus coat protein binds C1q and MBL and inhibits the classical and lectin pathways of complement activation.
19656971 2009 Influenza A virus M1 blocks the classical complement pathway through interacting with C1qA.
19493541 2009 Complement C1Q polymorphisms modulate onset in familial amyloidotic polyneuropathy TTR Val30Met.
19484134 2009 Complement C1q activates tumor suppressor WWOX to induce apoptosis in prostate cancer cells.
19440201 2009 Evaluation of C1q genomic region in minority racial groups of lupus.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18927313 2008 A polymorphism in the complement component C1qA correlates with prolonged response following rituximab therapy of follicular lymphoma.
18505047 2008 PCR-RFLP genotyping of C1q mutations and single nucleotide polymorphisms in Malaysian patients with systemic lupus erythematosus.
18504288 2009 Analysis of C1q polymorphisms suggests association with systemic lupus erythematosus, serum C1q and CH50 levels and disease severity.
18406463 2008 Native, amyloid fibrils and beta-oligomers of the C-terminal domain of human prion protein display differential activation of complement and bind C1q, factor H and C4b-binding protein directly.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18054386 2008 Studies on the haemolytic activity of circulating C1q-C3/C4 complexes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17929239 Complement C1q-target proteins recognition is inhibited by electric moment effectors.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16566583 2006 Interaction of C1q with IgG1, C-reactive protein and pentraxin 3: mutational studies using recombinant globular head modules of human C1q A, B, and C chains.
16465510 2006 The pattern of clinical breast cancer metastasis correlates with a single nucleotide polymorphism in the C1qA component of complement.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16046396 2005 The extracellular matrix and inflammation: fibromodulin activates the classical pathway of complement by directly binding C1q.
15878871 2005 Analysis of binding sites in human C-reactive protein for Fc{gamma}RI, Fc{gamma}RIIA, and C1q by site-directed mutagenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15034050 2004 Mutational analyses of the recombinant globular regions of human C1q A, B, and C chains suggest an essential role for arginine and histidine residues in the C1q-IgG interaction.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12960167 2003 The crystal structure of the globular head of complement protein C1q provides a basis for its versatile recognition properties.
12847249 2003 Modular organization of the carboxyl-terminal, globular head region of human C1q A, B, and C chains.
12645945 2003 Biochemical and functional characterization of the interaction between pentraxin 3 and C1q.
12630757 2003 Homozygous single nucleotide polymorphism of the complement C1QA gene is associated with decreased levels of C1q in patients with subacute cutaneous lupus erythematosus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11714829 2001 Surfactant protein A regulates complement activation.
10878362 2000 Interaction of C1q and mannan-binding lectin (MBL) with C1r, C1s, MBL-associated serine proteases 1 and 2, and the MBL-associated protein MAp19.
10528211 1999 C1q and C4b bind simultaneously to CR1 and additively support erythrocyte adhesion.
9777412 1998 Molecular basis of hereditary C1q deficiency.
9476117 1997 The C1q and collectin binding site within C1q receptor (cell surface calreticulin).
9461517 1998 C1q-mediated chemotaxis by human neutrophils: involvement of gClqR and G-protein signalling mechanisms.
9225968 1997 Multiple identification of a particular type of hereditary C1q deficiency in the Turkish population: review of the cases and additional genetic and functional analysis.
9184145 1997 Histidine-rich glycoprotein binds to human IgG and C1q and inhibits the formation of insoluble immune complexes.
9013976 1997 Secreted chondroitin sulfate proteoglycan of human B cell lines binds to the complement protein C1q and inhibits complex formation of C1.
8840296 1996 Molecular basis of hereditary C1q deficiency associated with SLE and IgA nephropathy in a Turkish family.
8778019 1996 The collagen-like component of the complement system, C1q, is recognized by 7 S autoantibodies and is functionally impaired in synovial fluids of patients with rheumatoid arthritis.
8417122 1993 Human serum amyloid P component oligomers bind and activate the classical complement pathway via residues 14-26 and 76-92 of the A chain collagen-like region of C1q.
8195709 1994 Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular "heads" of C1q.
8172568 1993 Regulation of the synthesis of C1 subcomponents and C1-inhibitor.
7939135 1994 Expression of the components and regulatory proteins of the classical pathway of complement in normal and diseased synovium.
6981411 1982 Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement.
6981115 1982 Fibronectin binds to the C1q component of complement.
2372546 1990 NH2-terminal calcium-binding domain of human complement C1s- mediates the interaction of C1r- with C1q.
1706597 1991 Characterization and organization of the genes encoding the A-, B- and C-chains of human complement subcomponent C1q. The complete derived amino acid sequence of human C1q.
1537612 1992 Localization of the gene cluster encoding the A, B, and C chains of human C1q to 1p34.1-1p36.3.
1431141 1992 The proteoglycan decorin binds C1q and inhibits the activity of the C1 complex.
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.
486087 1979 Complete amino acid sequences of the three collagen-like regions present in subcomponent C1q of the first component of human complement.
7240 1976 Isolation, by partial pepsin digestion, of the three collagen-like regions present in subcomponent Clq of the first component of human complement.