Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8297 1.4e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.000 1.4e-05

Synonym

Accession Q9BQ61
Symbols TERCIR
fSAP18
C19orf43

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAARGRRAEPQGREAPGPAGGGGGGSRWAESGSGTSPESGDEEVSGAGSSPVSGGVNLFANDGSFLELFK      1 - 70
RKMEEEQRQRQEEPPPGPQRPDQSAAAAGPGDPKRKGGPGSTLSFVGKRRGGNKLALKTGIVAKKQKTED     71 - 140
EVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTRPLVK                                      141 - 176
//

Text Mined References (9)

PMID Year Title