Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-06
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

AA Sequence

MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGGQAGSRRRPSAPCSQDRAAAE      1 - 70
GAPALLGGSPSSGSPGHPPGSAFGVEAGCRALNVSEHARGGFALGLPFGLSGGAYLFLLLDGAGDPKPTP     71 - 140
EAPISSADGRAWFPSESSWQLPQLPAGSTSGSEPRARPGLGPRQLLTGPRDGAAGQGPGRGLTARLGRER    141 - 210
EIDCGPRQAGHGGTATDTGRAGSGARHRPPRDRGTPGLRTH                                 211 - 251
//

Text Mined References (9)

PMID Year Title