Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 7.6e-07
medulloblastoma, large-cell 6234 1.0e-06
adrenocortical carcinoma 1427 6.1e-03
astrocytic glioma 2241 9.6e-03
ependymoma 2514 2.9e-02
Disease Target Count Z-score Confidence
Gastric cardia adenocarcinoma 4 4.611 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 9.6e-03
ependymoma -1.200 2.9e-02
medulloblastoma, large-cell -1.900 1.0e-06
adrenocortical carcinoma 1.018 6.1e-03
ovarian cancer -1.300 7.6e-07

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
20016921 Using acetylated HIV-1 IN as bait in yeast two-hybrid screening identifies CCDC32 as IN-binding partner

AA Sequence

MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAP      1 - 70
LQDSEVYLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFK     71 - 140
RWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ                             141 - 185
//

Text Mined References (8)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.