Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.23
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 1.4

AA Sequence

MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECS      1 - 70
TCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQM                    71 - 125
//

Text Mined References (7)

PMID Year Title