Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.40
PubTator Score 27.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.600 2.5e-02
diabetes mellitus -1.200 1.3e-03
lung cancer 1.500 1.5e-04
Multiple myeloma 1.014 4.9e-03
ovarian cancer -1.900 5.0e-07
Waldenstrons macroglobulinemia 1.057 3.1e-03

Gene RIF (12)

AA Sequence

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP      1 - 70
FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL     71 - 140
LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE    141 - 210
ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR                                        211 - 244
//

Text Mined References (28)

PMID Year Title