Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
nasopharyngeal carcinoma 1.100 1.3e-05
non-small cell lung cancer 1.072 2.7e-15
ovarian cancer 1.100 3.2e-03

AA Sequence

MPAGVPMSTYLKMFAASLLAMCAGAEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL      1 - 70
K//

Text Mined References (4)

PMID Year Title