Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.03
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.2e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 2.2e-06

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MEPGEELEEEGSPGGREDGFTAEHLAAEAMAADMDPWLVFDARTTPATELDAWLAKYPPSQVTRYGDPGS      1 - 70
PNSEPVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLD     71 - 140
HAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTY    141 - 210
LGIYRANRWHLCPTLYESRFQLGGSARGSRVLDRANNVELT                                 211 - 251
//

Text Mined References (15)

PMID Year Title