Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.00
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Melanoma 261
Disease Target Count P-value
ovarian cancer 8491 2.2e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 2.2e-06

Synonym

Accession Q9H3H3 J3KQG9 Q9BT13
Symbols P5326
BLES03

Gene

PDB

1ZTP   2Q4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
16511166 crystal structure of the human basophilic leukemia-expressed protein (BLES03, p5326, Hs.433573) was determined by single-wavelength anomalous diffraction and refined to an R factor of 18.8% (Rfree = 24.5%) at 2.5 A resolution

AA Sequence

MEPGEELEEEGSPGGREDGFTAEHLAAEAMAADMDPWLVFDARTTPATELDAWLAKYPPSQVTRYGDPGS      1 - 70
PNSEPVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLD     71 - 140
HAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTY    141 - 210
LGIYRANRWHLCPTLYESRFQLGGSARGSRVLDRANNVELT                                 211 - 251
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25062915 2014 Genome-wide search for eliminylating domains reveals novel function for BLES03-like proteins.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
17850744 2007 Ensemble refinement of protein crystal structures: validation and application.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16511166 2005 The structure at 2.5 A resolution of human basophilic leukemia-expressed protein BLES03.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.