Property Summary

NCBI Gene PubMed Count 9
PubMed Score 31.79
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.100 8.1e-04
invasive ductal carcinoma -1.200 5.6e-03
ovarian cancer -2.400 1.4e-10
pancreatic ductal adenocarcinoma liver m... -1.697 3.8e-03

AA Sequence

MSAARESHPHGVKRSASPDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGDHKSTSHFRTG      1 - 70
EEDKKINEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDDDDDDSPDPESPDDSESDS     71 - 140
ESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKSSGS                               141 - 183
//

Text Mined References (26)

PMID Year Title