Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
substance-related disorder 104 0.0 1.0


Accession Q8N4M7 Q5T2Z8
Symbols bA492M23.1

 Compartment GO Term (0)

AA Sequence

GKEAKKAGPGFHRQLLYLQFQKRCLFNYPELL                                          141 - 172

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.