Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 9.4e-13

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.500 9.4e-13

AA Sequence

MAKSERRIYSMESMAPEISEDIGCPLAYMRESVCALLINQSFFSCVAEMYIPDMNRPGKAERRAEKGLRP      1 - 70
PRKLVGETRRLQSWPTLARWLRRVSFSLYKPPIQAAPEPDPGNWAKSPRLSLGPEGITKGKHGFKFQGIK     71 - 140
EKFNVSKKVLKMTFL                                                           141 - 155
//

Text Mined References (5)

PMID Year Title