1. Home
  2. Targets
  3. Protein DEPP

Tbio Protein DEPP

May play a role in autophagy.

The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the encoded protein leads to phosphorylation and activation of the transcription factor ELK1. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 22
PubMed Score 376.25
PubTator Score 19.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Obesity 616 4.505 2.3
Hypoglycemia 81 4.146 2.1
Hypogonadotropism 9 3.276 1.6

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -5.100 6.1e-08
psoriasis -2.300 3.1e-08
glioblastoma 1.900 2.5e-02
atypical teratoid / rhabdoid tumor -1.800 1.7e-03
medulloblastoma -1.300 8.0e-03
medulloblastoma, large-cell -1.900 3.8e-02
acute quadriplegic myopathy 1.560 1.7e-06
adrenocortical carcinoma -1.491 5.0e-03
non-small cell lung cancer -1.606 1.1e-11
intraductal papillary-mucinous adenoma (... -2.900 9.0e-05
intraductal papillary-mucinous carcinoma... -3.000 1.0e-03
intraductal papillary-mucinous neoplasm ... -2.100 7.3e-03
lung cancer -2.900 1.8e-06
active ulcerative colitis 2.053 3.1e-02
breast carcinoma -1.600 1.1e-03
fibroadenoma -2.100 5.8e-03
posterior fossa group B ependymoma -2.000 1.0e-04
lung adenocarcinoma -2.600 4.2e-15
lung carcinoma -1.500 1.8e-06
Breast cancer -2.200 2.4e-12
gastric carcinoma 1.100 1.5e-02
ductal carcinoma in situ -2.400 3.0e-05
invasive ductal carcinoma -2.500 6.7e-05
ovarian cancer 1.500 5.9e-03
pituitary cancer -2.900 2.5e-05

Synonym

Accession Q9NTK1 B2R6A1 O94997 Q5T735 Q76MX8
Symbols FIG
DEPP
Fseg

Gene

C10orf10

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (4)

 GO Component (1)

 Compartment GO Term (14)

 MGI Phenotype (1)

 HCA RNA Cell Line (55)

See all...

Pathway (1)

Gene RIF (9)

PMID Text
25261981 Knockdown of DEPP prevented the primary and secondary reactive oxygen species wave during FOXO3 activation.
24936657 C10orf10 expression is frequently decreased in breast cancer tissues and is associated with shorter survival times.
21510935 DEPP is regulated at the level of transcription by FoxO in human vascular endothelial cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20822508 Observational study of gene-disease association. (HuGE Navigator)
19937567 DEPP is a novel insulin-regulatory molecule expressed abundantly in insulin-sensitive tissues including white adipose tissue and liver.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16123073 Depp modulates the effects of progesterone during decidualization and in the decidua by affecting gene expression.
15977181 Expressed in endothelial cells of peripheral tissues, but not in atrial or ventricular endocardial cells of the heart, unexpected degree of molecular heterogeneity among arterial endothelial cells, up-regulated in subsets of endothelial cells.

AA Sequence 

MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPA      1 - 70
QACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMD     71 - 140
SSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIH    141 - 210
EL                                                                        211 - 212
//

Text Mined References (22)

PMID Year Title
25261981 2014 C10ORF10/DEPP, a transcriptional target of FOXO3, regulates ROS-sensitivity in human neuroblastoma.
24936657 2014 Decreased expression of C10orf10 and its prognostic significance in human breast cancer.
24530860 2014 The c10orf10 gene product is a new link between oxidative stress and autophagy.
21510935 2011 FoxO regulates expression of decidual protein induced by progesterone (DEPP) in human endothelial cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20822508 2010 Association between CETP Taq1B and LIPC -514C/T polymorphisms with the serum lipid levels in a group of Tehran's population: a cross sectional study.
19937567 2010 Insulin-mediated regulation of decidual protein induced by progesterone (DEPP) in adipose tissue and liver.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16123073 2005 A novel protein Depp, which is induced by progesterone in human endometrial stromal cells activates Elk-1 transcription factor.
15977181 2005 Isolation of arterial-specific genes by subtractive hybridization reveals molecular heterogeneity among arterial endothelial cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.