Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.00
PubTator Score 56.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.2e-05
glioblastoma 5572 7.6e-04
Multiple myeloma 1327 5.9e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.003 5.9e-03
glioblastoma 1.500 7.6e-04
ovarian cancer 2.300 2.2e-05

Synonym

Accession P41223 A4D274 B7Z4S9 D6W5S6 Q6IB53 Q9UDV1
Symbols G10
EDG2
Cwc14
EDG-2
fSAP17
YCR063W

Gene

PDB

4OED   4OH6   4OKB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (161)

U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   BCAS2   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   HNRNPL   GCFC2   POLR2C   POLR2E   HNRNPA2B1   POLR2A   U2AF2   PTBP1   POLR2B   HNRNPH1   CSTF2   GTF2F1   POLR2I   RBMX   EIF4A3   SKIV2L2   PAPOLA   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   RBM5   POLR2K   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   SRSF7   USP39   PRPF8   FIP1L1   CWC27   DDX46   PHF5A   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   DDX23   SF3B5   UPF3B   CRNKL1   WDR33   CSTF2T   CWC22   XAB2   RBM22   CWC25   CWC15   CPSF2   TFIP11   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM2   LSM5   LSM4   RBM8A  

Gene RIF (2)

PMID Text
25731616 High BUD31 expression is associated with hepatocellular carcinoma.
22944692 Positional proteomics analysis identifies the cleavage of human BUD31 homolog (S. cerevisiae) (BUD31) at amino acid residues 17-18 by the HIV-1 protease

AA Sequence

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAI      1 - 70
SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCR     71 - 140
GCSG                                                                      141 - 144
//

Text Mined References (11)

PMID Year Title
25731616 2015 Meta-analysis of gene expression profiles indicates genes in spliceosome pathway are up-regulated in hepatocellular carcinoma (HCC).
25416956 2014 A proteome-scale map of the human interactome network.
25091737 2014 Identification of a new androgen receptor (AR) co-regulator BUD31 and related peptides to suppress wild-type and mutated AR-mediated prostate cancer growth via peptide screening and X-ray structure analysis.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7841202 1995 Characterization of edg-2, a human homologue of the Xenopus maternal transcript G10 from endothelial cells.