Property Summary

Ligand Count 9
NCBI Gene PubMed Count 105
PubMed Score 200.01
PubTator Score 145.65

Knowledge Summary

Patent (20,701)


  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.143 2.1


  Differential Expression (30)

Disease log2 FC p
active Crohn's disease 1.149 7.1e-03
adrenocortical carcinoma 2.691 1.1e-04
adult high grade glioma 2.400 1.7e-04
Atopic dermatitis 2.200 9.4e-05
atypical teratoid / rhabdoid tumor 3.500 5.3e-10
Breast cancer 2.800 7.7e-15
breast carcinoma 1.500 2.6e-28
colon cancer 2.000 9.9e-04
ductal carcinoma in situ 2.100 4.3e-03
Endometriosis 1.509 1.4e-02
ependymoma 1.700 4.3e-05
glioblastoma 3.400 5.0e-10
group 3 medulloblastoma 4.100 3.3e-09
intraductal papillary-mucinous carcinoma... 1.600 3.9e-04
intraductal papillary-mucinous neoplasm ... 2.600 2.6e-04
invasive ductal carcinoma 2.800 2.9e-05
lung adenocarcinoma 1.300 2.2e-08
lung cancer 1.400 1.5e-03
malignant mesothelioma 1.500 2.4e-07
medulloblastoma, large-cell 3.700 4.2e-07
nasopharyngeal carcinoma 1.400 1.3e-03
non-small cell lung cancer 3.225 1.6e-35
osteosarcoma -2.011 5.9e-05
ovarian cancer 2.100 6.0e-05
pancreatic cancer 2.000 7.4e-03
pancreatic carcinoma 2.000 7.4e-03
primary Sjogren syndrome 1.200 5.2e-03
primitive neuroectodermal tumor 4.100 8.5e-07
psoriasis -1.700 4.3e-03
ulcerative colitis 1.600 3.6e-04

Protein-protein Interaction (8)

Gene RIF (74)

AA Sequence

RQKLKKVFQQHYTNKIRALRNRLIVLLLECKRSRK                                      1051 - 1085

Text Mined References (118)

PMID Year Title