Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.86
PubTator Score 18.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 1.3e-03
osteosarcoma -1.444 8.5e-05
lung cancer -2.500 3.1e-03
active Crohn's disease 1.474 5.2e-03
active ulcerative colitis 1.121 6.4e-03
pilocytic astrocytoma 1.500 1.9e-07
primary Sjogren syndrome 1.100 1.1e-02
lung carcinoma -1.500 6.4e-18
ovarian cancer 1.400 8.5e-05

Gene RIF (11)

PMID Text
26475929 These findings support intracellular sensing of prenyl pyrophosphates by BTN3A1 rather than extracellular presentation.
25637025 Human gamma-delta T cells are activated by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25065532 Ligand binding to the BTN3A1 B30.2 domain affects residues in the juxtamembrane region, suggesting ligand-induced conformational change.
24890657 evidence that gene(s) on Chr6 in addition to BTN3A1 are mandatory for PAg-mediated activation of Vgamma9Vdelta2 T cells.
24703779 These studies demonstrate that internal sensing of changes in pAg metabolite concentrations by BTN3A1 molecules is a critical step in Vgamma9Vdelta2 T cell detection of infection and tumorigenesis.
23872678 BTN3A1 represents an antigen-presenting molecule required for the activation of Vgamma9Vdelta2 T cells.
22846996 BTN3A1 is necessary for Vgamma9Vdelta2 activation and begin to unravel the extracellular events that occur during stimulation through the Vgamma9Vdelta2 T cell receptor.
22767497 investigation of role of CD277 in activation/inactivation of T-lymphocytes: Data indicate that modulation of CD277 interaction (with agonists or blocking antibodies) with T-cell antigen receptor can modulate activation/inactivation of T-lymphocytes.
21918970 CD277 triggering is not involved in CD16- or NKp46-induced NK cell activation.
21113407 Results point to a role for CD277 up-regulated by microenvironmental signals in the acquisition of a regulatory phenotype by ovarian tumor-associated myeloid cells.
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM    141 - 210
RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ    211 - 280
FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN    281 - 350
PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG    351 - 420
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF    421 - 490
SEALYPVFRILTLEPTALTICPA                                                   491 - 513
//

Text Mined References (24)

PMID Year Title
26475929 2015 Sensor Function for Butyrophilin 3A1 in Prenyl Pyrophosphate Stimulation of Human V?2V?2 T Cells.
25637025 2015 Activation of human ?? T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25065532 2014 Synthesis of a phosphoantigen prodrug that potently activates V?9V?2 T-lymphocytes.
24890657 2014 V?9V?2 TCR-activation by phosphorylated antigens requires butyrophilin 3 A1 (BTN3A1) and additional genes on human chromosome 6.
24703779 2014 The intracellular B30.2 domain of butyrophilin 3A1 binds phosphoantigens to mediate activation of human V?9V?2 T cells.
23872678 2013 Butyrophilin 3A1 binds phosphorylated antigens and stimulates human ?? T cells.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
21113407 2010 CD277 is a negative co-stimulatory molecule universally expressed by ovarian cancer microenvironmental cells.
20610803 2010 Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
20208008 2010 BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.
9382921 1997 Cloning, localization, and structure of new members of the butyrophilin gene family in the juxta-telomeric region of the major histocompatibility complex.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.