Property Summary

NCBI Gene PubMed Count 75
PubMed Score 51.17
PubTator Score 107.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.909 2.0

Expression

Protein-protein Interaction (11)

Gene RIF (60)

PMID Text
26771717 Phosphorylation of BRMS1 by CDK2 regulates the migration of tumor cells.
26617826 Aberrant methylation of BRMS1 frequently occurs in the down-regulation of BRMS1 in triple negative breast cancer and that it may play a role in the metastasis of breast cancer.
26544623 Data show that Cullin3 exerts its function through promoting breast-cancer metastasis suppressor 1 (BRMS1) protein degradation, which was associated with epithelial-mesenchymal transition (EMT), migration and invasion.
26520789 the present study demonstrates a mechanical cascade of BRMS1 suppressing cancer cell invasion through downregulating HIF-1alpha transcript and consequently reducing Snail and TWIST1 expression.
26328523 The studies reviewed here with respect to BRMS1 structure, cellular effects, intracellular signaling, and clinical value consolidate the importance of BRMS1 in the development of metastasis.
26182878 BRMS1 expression in human breast cancer is negatively correlated with JARID1C expression. Our results, for the first time, portray a pivotal role of JARID1C in regulating metastatic behaviors of breast cancer cells
25854163 MRTF-A and STAT3 synergistically recruited DNMT1 to hypermethylate the promoter of BRMS1 and affect the expression of BRMS1.MRTF-A and STAT3 promote breast cancer cell migration via hypermethylating BRSM1.
25368381 loss of BRMS1 promotes malignant phenotypes that are dependent on NF-kappaB-dependent regulation of Twist1
24984534 Silencing of BRMS 1 significantly induced the expression of NF-kappaB subunit, p65, uPA, and OPN proteins
24879377 BRMS1 overexpression inhibited glioma cell invasion.
24763730 BRMS1 is a key regulator required to maintain a cellular morphology and cytoskeletal architecture consistent with an epithelial phenotype.
24748145 high expression of BRSM1 in rectal cancer plays an essential role in tumor progression
24642624 Methylation of BRMS1 promoter in cfDNA isolated from plasma of NSCLC patients provides important prognostic information and merits to be further evaluated as a circulating tumour biomarker.
24596389 Low levels of BRMS1 were observed in patients with high-grade tumors, in patients with distant metastasis in breast cancer.
24000122 BRMS1-expressing cells remained rounded.
23771732 BRMS1 SNP rs1052566 heterozygous individuals were more likely to have node-positive breast tumors.
23744981 Data define BRMS1 promoter methylation in primary breast tumors and associated circulating tumor cells.
23643861 Report BRMS1 transcript variant which regulates heptocellular carcinoma apoptosis and growth.
23500495 Authors observed that residues 85 to 98 might be important in defining the oligomerization state of the BRMS1 N-terminal coiled coil.
23390556 The C-terminal putative nuclear localization sequence (NSL2) of BRMS1 is necessary for metastasis suppression.
23269275 Data indicate that mutation of E3 ligase motif not only abolishes BRMS1-induced p300 polyubiquitination and degradation, but importantly, dramatically reduces the metastasis suppressor function of BRMS1.
23167184 The expression of BRMS1 protein in supraglottic cancer is significantly decreased. BRMS1 gene promotor methylation is related with down-expression of BRMS1 protein.
22931099 Data suggest that low expression of the metastasis suppressor BRMS1 may be an independent prognostic factor for poor prognosis in nasopharyngeal carcinoma (NPC) patients.
22927944 BRMS1 sensitizes HCC cells to apoptosis through suppressing OPN expression
22239051 The loss of BRMS1 expression may be involved in the development and progression of nasal and paranasal sinus carcinomas.
22200669 Loss of breast cancer metastasis suppressor 1 promotes ovarian cancer cell metastasis by increasing chemokine receptor 4 expression.
22085717 These results suggest that the novel regulatory mechanism of BRMS1 by Cul3-SPOP complex is important for breast cancer progression.
21827753 the enigmatic complexities of BRMS1-mediated metastasis suppression
21737612 possible link between BRMS1 expression and apoptosis in human breast cancer through a relationship with the expression of genes belonging to the X-chromosome RBM family.
21726917 high level of expression and lack of promoter methylation are associated with better overall survival in non-small cell lung cancer patients
21355308 SATB1 and BRMS1 might play an important role in the development and lymph node metastasis of ovarian cancer.
21056991 ING4 is induced by BRMS1 and that it inhibits melanoma angiogenesis by suppressing NF-kappaB activity and IL-6 expression.
20935672 BRMS1 expression was decreased in metastatic melanomas, which resulted in deficient suppression of angiogenesis and contributed to melanoma progression.
20830743 Study observed that SNX6 increases BRMS1-dependent transcriptional repression. Moreover, over-expression of SNX6 was capable of diminishing trans-activation in a dose-dependent manner.
20083343 BRMS1 expression in breast cancer cells induced reorganization of F-actin and caused alteration in cytoarchitectures (cell topography and ultrastructure).
19621595 The expression of BRMS1 protein in supraglottic cancer is significantly decreased. Expression has a close relationship with pathologic differentiation and clinical stage and cervical lymph node metastasis.
19609101 Loss of nuclear BRMS1 was associated with ER-negative cancers and a high rate of proliferation, but was not an independent indicator of prognosis.
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19307053 Chemosensitivity of breast cancer cells is preserved in the presence of recombinant BRMS1. BRMS1 does not change expression of AKT isoforms or PTEN, implicated in chemoresistance to common drug agents.
19165610 BRMS1 recruits HDAC1 to the NF-kappaB binding site of the uPA promoter, modulates histone acetylation of p65 on the uPA promoter, leading to reduced NF-kappaB binding activity on its consensus sequence, and reduced transactivation of uPA expression.
19111386 BRMS1 functions as a metastasis suppressor and may be a prognostic indicator for human non-small cell lung cancer.
19052374 Here, the expression, purification and crystallization of a functional fragment of human BRMS1 that is predicted to be a coiled-coil region are reported
18841483 expression of the characteristic *35 kDa BRMS1 protein is not sufficient to prevent metastasis. The differential expression of alternative splice variants suggests caution should be taken when evaluating BRMS1 mRNA in clinical samples.
18664570 Breast cancer metastasis suppressor-1 differentially modulates growth factor signaling
18566899 BRMS1 is a novel target of epigenetic silencing; and aberrant methylation in the BRMS1 promoter may serve as a cause of loss of its expression.
18543067 BRMS1 is a potent suppressor of metastasis in multiple organs, and identify two steps in the metastatic process that are sensitive to inhibition by BRMS1.
18533556 Expression of BRMS1 mRNA in supraglottic cancer is lower than that in adjacent normal mucosa.
18502034 Breast cancer metastasis suppressor 1 inhibits SDF-1alpha-induced migration of non-small cell lung cancer by decreasing CXCR4 expression.
18470911 OPN downregulation by BRMS1 may be responsible, at least in part, for BRMS1-mediated metastasis suppression by sensitizing cancer cells to stress induced apoptosis.
18276787 BRMS1 inhibits metastases in multiple organs by blocking several steps in the metastatic cascade.
18211900 Alterations of BRMS1-ARID4A interaction modify gene expression but still suppress metastasis in human breast cancer cells.
17896182 The pattern of gene expression associated with BRMS1 expression suggests that metastasis suppression may be mediated by enhanced immune recognition, altered transport, and/or secretion of metastasis-associated proteins.
17854218 Available evidence on the reported functions of the identified proteins supports the emerging role of BRMS1 as negative regulator of the metastasis development.
17227585 Results show that BRMS1 regulates Osteopontin transcription by abrogating NF-kappaB activation
17085653 Patients with high levels of expression of BRMS1 mRNA have a better prognosis than those with low expression.
15592684 Our investigations revealed significantly reduced mRNA expression of metastases suppressor gene BRMS1 in breast cancer brain metastasis.
15168732 To further characterize BRMS1-mediated metastasis suppression, proteins differentially expressed between highly metastatic MDA-MB-435 cells & BRMS1-transfected MDA-MB-435 cells were identified. Differential expression was found for 5 proteins.
14581478 BRMS1 may participate in transcriptional regulation via interaction with the mSin3.HDAC complex
12650606 BRMS1 has subsequently been shown to suppress metastasis, but not tumorigenicity of human melanoma cells.
11822878 BRMS1 functions as a metastasis suppressor in more than one tumor type(i.e., breast carcinoma and cutaneous melanoma)by modifying several metastasis-associated phenotypes.

AA Sequence

MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ      1 - 70
FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG     71 - 140
AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG    141 - 210
PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP                                      211 - 246
//

Text Mined References (77)

PMID Year Title
26771717 2016 Cyclin-dependent kinase-mediated phosphorylation of breast cancer metastasis suppressor 1 (BRMS1) affects cell migration.
26617826 2015 Down-regulation of BRMS1 by DNA hypermethylation and its association with metastatic progression in triple-negative breast cancer.
26544623 2015 Cullin3 promotes breast cancer cells metastasis and epithelial-mesenchymal transition by targeting BRMS1 for degradation.
26520789 2015 Breast cancer metastasis suppressor 1 (BRMS1) attenuates TGF-?1-induced breast cancer cell aggressiveness through downregulating HIF-1? expression.
26328523 2015 Breast carcinoma metastasis suppressor gene 1 (BRMS1): update on its role as the suppressor of cancer metastases.
26182878 2015 Histone demethylase JARID1C promotes breast cancer metastasis cells via down regulating BRMS1 expression.
25854163 2015 MRTF-A and STAT3 promote MDA-MB-231 cell migration via hypermethylating BRSM1.
25416956 2014 A proteome-scale map of the human interactome network.
25368381 2015 Loss of BRMS1 promotes a mesenchymal phenotype through NF-?B-dependent regulation of Twist1.
24984534 2014 BRMS1 inhibits expression of NF-kappaB subunit p65, uPA and OPN in ovarian cancer cells.
24879377 2014 BRMS1 suppresses glioma progression by regulating invasion, migration and adhesion of glioma cells.
24763730 2014 Inhibition of breast cancer metastasis suppressor 1 promotes a mesenchymal phenotype in lung epithelial cells that express oncogenic K-RasV12 and loss of p53.
24748145 2014 Effect of BRMS1 on tumorigenicity and metastasis of human rectal cancer.
24642624 2014 Breast cancer metastasis suppressor-1 promoter methylation in cell-free DNA provides prognostic information in non-small cell lung cancer.
24596389 2014 Expression of breast cancer metastasis suppressor-1, BRMS-1, in human breast cancer and the biological impact of BRMS-1 on the migration of breast cancer cells.
24000122 2014 Expression of metastasis suppressor BRMS1 in breast cancer cells results in a marked delay in cellular adhesion to matrix.
23771732 2013 Case-only analyses of the associations between polymorphisms in the metastasis-modifying genes BRMS1 and SIPA1 and breast tumor characteristics, lymph node metastasis, and survival.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23744981 2013 Breast cancer metastasis suppressor-1 promoter methylation in primary breast tumors and corresponding circulating tumor cells.
23643861 2013 Cloning and characterization of a novel human BRMS1 transcript variant in hepatocellular carcinoma cells.
23500495 2013 BRMS151-98 and BRMS151-84 are crystal oligomeric coiled coils with different oligomerization states, which behave as disordered protein fragments in solution.
23390556 2013 The C-terminal putative nuclear localization sequence of breast cancer metastasis suppressor 1, BRMS1, is necessary for metastasis suppression.
23269275 2013 BRMS1 suppresses lung cancer metastases through an E3 ligase function on histone acetyltransferase p300.
23167184 2012 [The study of expression of BRMS1 gene protein and the expression of BRMS1 gene promotor area methylation in supraglottic laryngeal carcinoma and its clinical significance].
22931099 2012 Low BRMS1 expression promotes nasopharyngeal carcinoma metastasis in vitro and in vivo and is associated with poor patient survival.
22927944 2012 Breast cancer metastasis suppressor 1 regulates hepatocellular carcinoma cell apoptosis via suppressing osteopontin expression.
22239051 2011 [Expression of BRMS1 gene protein in nasal and paranasal sinus carcinomas].
22200669 2012 Loss of breast cancer metastasis suppressor 1 promotes ovarian cancer cell metastasis by increasing chemokine receptor 4 expression.
22085717 2011 Breast cancer metastasis suppressor 1 (BRMS1) is destabilized by the Cul3-SPOP E3 ubiquitin ligase complex.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21827753 2011 Unraveling the enigmatic complexities of BRMS1-mediated metastasis suppression.
21777593 2011 The structure of BRMS1 nuclear export signal and SNX6 interacting region reveals a hexamer formed by antiparallel coiled coils.
21737612 mRNA expression of the putative antimetastatic gene BRMS1 and of apoptosis-related genes in breast cancer.
21726917 2011 Promoter methylation of BRMS1 correlates with smoking history and poor survival in non-small cell lung cancer patients.
21355308 2011 [Expression of SATB1 and BRMS1 in ovarian serous adenocarcinoma and its relationship with clinieopathological features].
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
21056991 2010 Cell cycle regulator ING4 is a suppressor of melanoma angiogenesis that is regulated by the metastasis suppressor BRMS1.
20935672 2011 Prognostic significance of BRMS1 expression in human melanoma and its role in tumor angiogenesis.
20830743 2010 Sorting nexin 6 interacts with breast cancer metastasis suppressor-1 and promotes transcriptional repression.
20083343 2010 BRMS1 expression alters the ultrastructural, biomechanical and biochemical properties of MDA-MB-435 human breast carcinoma cells: an AFM and Raman microspectroscopy study.
19621595 2009 [Expression of gene BRMS1 and CD44v6 protein in supraglottic laryngeal carcinoma and its clinical significance].
19609101 2009 A shift from nuclear to cytoplasmic breast cancer metastasis suppressor 1 expression is associated with highly proliferative estrogen receptor-negative breast cancers.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19307053 2009 Expression of the Breast Cancer Metastasis Suppressor 1 (BRMS1) maintains in vitro chemosensitivity of breast cancer cells.
19165610 2009 BRMS1 contributes to the negative regulation of uPA gene expression through recruitment of HDAC1 to the NF-kappaB binding site of the uPA promoter.
19111386 2009 Breast cancer metastasis suppressor 1 (BRMS1) suppresses metastasis and correlates with improved patient survival in non-small cell lung cancer.
19052374 2008 Crystallization and preliminary X-ray diffraction analysis of a breast cancer metastasis suppressor 1 predicted coiled-coil region.
18841483 2009 Multiple forms of BRMS1 are differentially expressed in the MCF10 isogenic breast cancer progression model.
18664570 2008 Breast cancer metastasis suppressor-1 differentially modulates growth factor signaling.
18566899 2008 Epigenetic silencing contributes to the loss of BRMS1 expression in breast cancer.
18543067 2008 BRMS1 suppresses breast cancer metastasis in multiple experimental models of metastasis by reducing solitary cell survival and inhibiting growth initiation.
18533556 2008 [Expression and clinical significance of breast cancer metastasis suppressor 1 mRNA in supraglottic laryngeal carcinoma].
18502034 2008 Breast cancer metastasis suppressor 1 inhibits SDF-1alpha-induced migration of non-small cell lung cancer by decreasing CXCR4 expression.
18470911 2008 Downregulation of osteopontin contributes to metastasis suppression by breast cancer metastasis suppressor 1.
18276787 2008 BRMS1 suppresses breast cancer experimental metastasis to multiple organs by inhibiting several steps of the metastatic process.
18211900 2008 Alterations of BRMS1-ARID4A interaction modify gene expression but still suppress metastasis in human breast cancer cells.
17896182 2007 Microarray analysis reveals potential mechanisms of BRMS1-mediated metastasis suppression.
17854218 2007 Proteomics-based strategy to delineate the molecular mechanisms of the metastasis suppressor gene BRMS1.
17227585 2007 Breast cancer metastasis suppressor 1 (BRMS1) inhibits osteopontin transcription by abrogating NF-kappaB activation.
17085653 2006 Reduced expression of the breast cancer metastasis suppressor 1 mRNA is correlated with poor progress in breast cancer.
17000776 2006 Breast cancer metastasis suppressor 1 functions as a corepressor by enhancing histone deacetylase 1-mediated deacetylation of RelA/p65 and promoting apoptosis.
16919237 2006 Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15867352 2005 Breast cancer metastasis suppressor 1 inhibits gene expression by targeting nuclear factor-kappaB activity.
15705865 2005 Metastasis suppression by breast cancer metastasis suppressor 1 involves reduction of phosphoinositide signaling in MDA-MB-435 breast carcinoma cells.
15592684 2005 Reduced metastasis-suppressor gene mRNA-expression in breast cancer brain metastases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
15168732 2004 Identification of metastasis-associated proteins through protein analysis of metastatic MDA-MB-435 and metastasis-suppressed BRMS1 transfected-MDA-MB-435 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14581478 2004 Breast cancer metastasis suppressor 1 (BRMS1) forms complexes with retinoblastoma-binding protein 1 (RBP1) and the mSin3 histone deacetylase complex and represses transcription.
12650606 2003 Breast cancer metastasis suppressor 1: update.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414911 2002 Transcriptional expression of genes involved in cell invasion and migration by normal and tumoral trophoblast cells.
11774238 2002 Identification and characterization of the murine ortholog (brms1) of breast-cancer metastasis suppressor 1 (BRMS1).
10850410 2000 Functional evidence for a novel human breast carcinoma metastasis suppressor, BRMS1, encoded at chromosome 11q13.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.