Property Summary

NCBI Gene PubMed Count 14
PubMed Score 40.24
PubTator Score 99.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.249 3.3e-06
adult high grade glioma 1.200 3.6e-05
atypical teratoid / rhabdoid tumor 1.400 3.5e-07
glioblastoma 1.200 2.2e-07
ovarian cancer -1.200 3.6e-04
pancreatic ductal adenocarcinoma liver m... -1.088 2.0e-02
primitive neuroectodermal tumor 1.100 2.0e-05

 GO Process (1)

Gene RIF (5)

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPAN      1 - 70
SIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA                    71 - 125
//

Text Mined References (15)

PMID Year Title