Property Summary

NCBI Gene PubMed Count 117
PubMed Score 2922.87
PubTator Score 236.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.796 9.3e-04
Rheumatoid Arthritis 2.700 5.3e-05
astrocytoma 2.200 4.6e-04
juvenile dermatomyositis 1.188 4.5e-10
pancreatic ductal adenocarcinoma liver m... 1.458 2.6e-02
tuberculosis and treatment for 6 months -1.200 4.5e-05
lung cancer 1.500 1.7e-04
ovarian cancer 2.200 7.6e-09

Synonym

Accession O60885 O60433 Q4G0X8 Q86YS8 Q96PD3
Symbols CAP
MCAP
HUNK1
HUNKI

Gene

PDB

2NCZ   2ND1   3UVW   3UVX   3UVY   3UW9   2LSP   4KV1   4KV4   2I8N   2MJV   2N3K   2ND0   2NNU   2OSS   2OUO   2YEL   2YEM   3MXF   3P5O   3SVF   3SVG   3U5J   3U5K   3U5L   3ZYU   4A9L   4BJX   4BW1   4BW2   4BW3   4BW4   4C66   4C67   4CFK   4CFL   4CL9   4CLB   4DON   4E96   4F3I   4GPJ   4HBV   4HBW   4HBX   4HBY   4HXK   4HXL   4HXM   4HXN   4HXO   4HXP   4HXR   4HXS   4IOO   4IOQ   4IOR   4J0R   4J0S   4J3I   4LR6   4LRG   4LYI   4LYS   4LYW   4LZR   4LZS   4MEN   4MEO   4MEP   4MEQ   4MR3   4MR4   4NQM   4NR8   4NUC   4NUD   4NUE   4O70   4O71   4O72   4O74   4O75   4O76   4O77   4O78   4O7A   4O7B   4O7C   4O7E   4O7F   4OGI   4OGJ   4PCE   4PCI   4PS5   4QB3   4QR3   4QR4   4QR5   4QZS   4UIX   4UIY   4UIZ   4UYD   4WHW   4WIV   4X2I   4XY9   4XYA   4YH3   4YH4   4Z1Q   4Z1S   4Z93   4ZC9   4ZW1   5A5S   5A85   5ACY   5BT4   5CFW   5COI   5CP5   5CPE   5CQT   5CRM   5CRZ   5CS8   5CTL   5CY9   5D0C   5D24   5D25   5D26   5D3H   5D3J   5D3L   5D3N   5D3P   5D3R   5D3S   5D3T   5DLX   5DLZ   5DW2   5DX4   5EGU   5EI4   5EIS   5FBX   5HLS   5HM0   5JWM   5KHM   5LJ1   5LJ2  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (114)

PMID Text
26858406 findings identify key structural features of the ET domain of Brd4 that allow for interactions with both cellular and viral proteins.
26855180 we found that NF-kappaB, BRD4 and RNA POL II were rapidly distributed at the upstream regions of miR-146a and miR-155, and more importantly mediated the formation of the super enhancers that drive miR-146a and miR-155 transcription.
26752646 the long noncoding RNA colon cancer-associated transcript 1 (CCAT1) is transcribed from this superenhancer and is exquisitely sensitive to BET inhibition.
26707881 In conclusion, our findings revealed that the aberrant expression of BRD4 in thyroid cancer is possibly involved in tumor progression, and JQ1 is potentially an effective chemotherapeutic agent against human thyroid cancer.
26626481 Study provides evidence that links the CHD8 chromatin remodeler to the cancer maintenance functions of BRD4 and NSD3.
26504077 novel actions of BRD4 and of NELF-E in GR-controlled gene induction have been uncovered.
26365679 HPV16 E2-Brd4 interaction is more responsible for the transcriptional activation of host genes rather than repression.
26324948 This study implicates BET Brds as important regulators of IkappaB kinase/NF-kappaB-mediated synovial inflammation of RA and identifies BET proteins as novel therapeutic targets in inflammatory arthritis.
26224795 BRD4 plays a key role in the pathological phenotype of pulmonary arterial hypertension.
26220994 discovered that the translocation oncoprotein BRD4-NUT protein occupies approximately 100-200 extremely broad, cell type-specific hyperacetylated domains in the genome
26119939 combined administration of lenalidomide and BRD4 inhibitor JQ-1 significantly increased the survival of PEL bearing NOD-SCID mice in an orthotopic xenograft model
26111795 Data show that Bromodomain Containing 4 protein (BRD4) binds to the HOTAIR promoter, suggesting that BET proteins can directly regulate long noncoding RNAs (lncRNAs) expression.
26093279 the BRD4 inhibition can inhibit joint inflammation and FBS-induced migration and invasion of human RA-FLS via decreasing the phosphorylation of c-Jun and activation of NFkappaB.
26083714 Essential for MYC expreession increase upon CDK9 inhibition is that the bromodomain protein BRD4 captures P-TEFb from 7SK snRNP to deliver to target genes and also enhances CDK9's activity and resistance to inhibition.
26044852 IL-10 disrupts the Brd4-docking sites to inhibit lipopolysaccharide-induced CXCL8 and TNF-alpha expression in monocytes.
25941994 Here we show that an enhancer proximal to the c-Myc promoter is enriched in H3K27Ac and associated with high occupancy of BRD4, and coincides with a putative c-Myc super-enhancer in MCC cells.
25892415 Results show that CCNE1 and BRD4 on chromosome 19 were amplified/overexpressed in a substantial cases of epithelial ovarian cancer with no involvement of BRCA genes.
25891802 Data suggest that BRD4 is essential for Toll-like receptor-stimulated interferon-beta (IFNB) gene transcription by permitting transcription factors to interact with the IFNB promoter in plasmacytoid dendritic cells.
25877301 Brd4 is a novel client protein of Hsp90, which protects Brd4 from degradation and contributes to the upregulation of Brd4 in cystic renal epithelial cells and tissues.
25788266 H4K12ac is regulated by estrogen receptor-alpha and is associated with BRD4 function and inducible transcription
25694599 The results suggest that interactions between TopBP1 and E2 and between Brd4 and E2 are required to correctly initiate human papillomavirus 16 DNA replication but are not required for continuing DNA replication.
25656449 this study reveals a novel function of BRD4 in controlling the germinal center B cell development pathway.
25647019 BRD4 was upregulated in pancreatic ductal adenocarcinoma cell lines. Its suppression reduced in vitro viability and proliferation, and decreased in vivo tumor growth synergistically with gemcitabine. BRD4 activated Shh signaling ligand-independently.
25512383 Data support a model in which BRD4-NUT-stimulated histone hyperacetylation recruits additional BRD4 and interacting partners to support transcriptional activation, which underlies the BRD4-NUT oncogenic mechanism in NMC.
25506891 This review describes the recruitment of BRD4 by Twist in the progression of basal-like breast cancer.
25340539 phosphorylation of serine 243 in the hinge region of HPV-16 E2 is essential for interaction with Brd4 and required for host chromosome binding
25284786 BRD4-mediated tumor protection is clinically relevant given that a BRD4 gene signature predicts positive clinical outcome in breast and lung cancer. Results show a protective function for BRD4 and suggest tissue-specific roles for BRD4 in tumorigenesis.
25263550 BRD4, a member of the bromodomain and extraterminal domain (BET) family of epigenetic readers, regulates the self-renewal ability and pluripotency of ESCs.
25140737 In this study, the authors show that recruitment of positive transcription elongation factor b, a functional interaction partner of Brd4 in transcription activation, is important for E2's transcription activation activity of human papillomavirus 16.
25120803 These results suggest that the aberrant expression of BRD4 in human urothelial carcinoma of the bladder is possibly involved in the tumorigenesis and development
25049379 An unexpected role for the bromodomain and extraterminal domain (BET) proteins BRD2 and BRD4 in maintaining oncogenic IKK activity in activated B-cell-like diffuse large B-cell lymphoma.
25017071 BRD4 occupies transcriptional start sites and estrogen response elements upon estrogen stimulation.
24939842 PP1alpha and class I histone deacetylase (HDAC1/2/3) signaling pathways are essential for the stress-induced BRD4 release from chromatin.
24860166 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
24832099 HPV replication, which hijacks host DNA damage responses, occurs adjacent to highly susceptible fragile sites bound to BRD4, greatly increasing the chances of integration here, as is found in HPV-associated cancers.
24796395 High BRD4 expression is associated with medulloblastoma.
24763052 A deregulation of BRD4 diminished the KEAP1/NRF2 axis and led to a disturbed regulation of the inducible heme oxygenase 1 (HMOX1).
24733848 BET proteins, particularly Brd2 and Brd4, may play a key role in the regulation of Nrf2-dependent antioxidant gene transcription and are hence an important target for augmenting antioxidant responses in oxidative stress-mediated diseases.
24664238 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding
24646477 Data indicate that inhibition of BET bromodomain proteins, including BRD4, as a promising bone tumor therapeutic strategy.
24584072 BRD4 binds and may sustain the activity of the regulatory elements and target genes required for the proliferation of T-ALL cells.
24525235 BRD4-TWIST Interaction increases tumorigenesis in basal-like breast cancer.
24497639 the contribution of individual BRD4 amino acids to histone and JQ1 binding
24448221 These studies bring new insights for understanding Brd4-mediated stabilization of human papillomavirus 16 E2 protein, and provide an additional mechanism by which the chromatin-associated Brd4 regulates E2 functions.
24445267 BRD4 is epigenetically regulated during hematopoietic differentiation ESCs in the context of a still unknown signaling pathway
24403256 BRD4 associates with p53 in DNMT3A-mutated leukemia cells.
24367103 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
24360279 Study reports that a unique cohort of JMJD6 and Brd4 cobound distal enhancers, termed anti-pause enhancers, regulate promoter-proximal pause release of a large subset of transcription units via long-range interactions.
24297863 BRD4 suppression attenuates expression of MYC in medulloblastoma cells.
24278023 while Brd4 can enhance replication by concentrating viral processes in specific regions of the host nucleus, this interaction is not absolutely essential for HPV replication.
24260471 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
24189064 Brd4 as a key regulator for Tax-mediated NF-kappaB gene expression
24146614 A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins.
24100334 Three crystallographic structures of the N-terminal bromodomain of BRD4 in complex with low-molecular-weight fragments are presented. Similar molecules mimicking acetylated lysine bind the bromodomain with different orientations and interactions.
24090311 Data indicate using virtual screening approach to identify BRD4 inhibitors.
24049186 BRD2, BRD3, and BRD4 interact with gammaretroviral INs and serve as cofactors for murine leukemia virus integration.
23818621 BET proteins promote efficient murine leukemia virus integration at transcription start sites.
23728299 data implicate Brd4, previously known for its role in transcriptional control, as an insulator of chromatin that can modulate the signalling response to DNA damage
23722886 The current knowledge pertaining to the role of Brd4 in papillomavirus infections is summarized. [Review]
23658523 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23658523 Knockdown of bromodomain containing 4 ( BRD4) by siRNA enhances HIV-1 replication in latently infected Jurkat T cells
23518577 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23370386 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23365439 Recruitment of Brd4 to the human papillomavirus type 16 DNA replication complex is essential for replication of viral DNA.
23324342 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23317504 the ability of Brd4 binding to chromatin and also the recruitment of p53 to regulated promoters
23255218 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23144621 Bromodomain protein Brd4 plays a key role in Merkel cell polyomavirus DNA replication
23128391 The novel BRD4-NUT fusion in which Exon 15 of BRD4 was fused to Exon 2 of NUT encodes a functional protein that is central to the oncogenic mechanism in these cells.
23115324 Brd2 and Brd4 proteins mediatE the responses of LFs after growth factor stimulation and drivE the induction of lung fibrosis in mice in response to bleomycin challenge.
23087374 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23087374 Knockdown of bromodomain containing 4 ( BRD4) by siRNA enhances HIV-1 replication in latently infected Jurkat T cells
23086925 BRD4-driven Pol II phosphorylation at serine 2 plays an important role in regulating lineage-specific gene transcription in human CD4+ T cells.
23041316 The inhibition of bromodomain containing 4 increases Tat-dependent transcriptional elongation and Tat-PTEF-b association.
23041316 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
23041316 Knockdown of bromodomain containing 4 ( BRD4) by siRNA enhances HIV-1 replication in latently infected Jurkat T cells
23027873 three CTD kinases, CDK7, CDK9, and BRD4, engage in cross-talk, modulating their subsequent C-terminal domain phosphorylation, and also phosphorylate TAF7
22645123 Down-regulation of NF-kappaB transcriptional activity in HIV-associated kidney disease by BRD4 inhibition.
22334664 novel structural role of Brd4 in supporting the higher chromatin architecture
22120039 BRD4 is frequently downregulated by aberrant promoter hypermethylation in human colon cancer cell lines and primary tumors.
22084242 model where two BRD4 domains, the second bromodomain and the PID, bind P-TEFb and are required for full transcriptional activation of P-TEFb response genes.
22035730 The BRDT gene was not expressed in testicular tissue from patients with Sertoli cells only, whereas the other three genes of the BET family retained expression in all the sperm pathologies.
21652721 study provides a novel mechanism by which the BRD4-NUT oncogene perturbs BRD4 functions to block cellular differentiation and to contribute to the oncogenic progression in the highly aggressive NUT midline carcinoma
21555454 Functional studies with Brd4 indicate that the ET domain mediates pTEFb-independent transcriptional activation through a subset of these associated factors, including NSD3.
21360054 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
20676058 Using a patient-derived cell line, the authors show that p300 sequestration into the chromatin-bound BRD4-NUT fusion protein foci is the principal oncogenic mechanism leading to p53 inactivation.
20201073 T-loop phosphorylated Cdk9 localizes to nuclear speckle domains which may serve as sites of active P-TEFb function and exchange between the Brd4 and 7SK/HEXIM1 regulatory complexes.
20036832 Studies indicate that KSHV LANA interacts with Brd2 and Brd4.
19846528 Abrogation of the interaction between P-TEFb and Brd4 thus provides a mechanism for E2-mediated repression of the viral oncogenes from the integrated viral genomes in cancer cells.
19596781 Brd4 is essential for the maintenance of the cell cycle progression mediated at least in part through the control of transcription of the Aurora B kinase cell cycle regulatory gene.
19553317 In addition to Brd4's role in mediating E2 transcription and genome tethering activities, these data suggest a potential role for Brd4 in regulating E2 stability and protein levels within papillomavirus-infected cells.
19211738 results indicate that the stability of human papillomavirus E2 is increased upon complex formation with Brd4
19129460 Bovine papillomavirus type 1 (BPV-1) E2 binds cellular chromatin in complex with Brd4 in both mitotic and interphase cells.
19103749 Brd4 as a novel coactivator of NF-kappaB through specifically binding to acetylated lysine-310 of RelA.
19038968 coactivator and corepressor function of Brd4 requires at least one intact bromodomain and is mediated by its direct association with E2 proteins encoded by various papillomaviruses
18996376 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
18971272 The authors provide evidence that Brd4 regulates P-TEFb kinase activity by inducing a negative pathway via phosphorylation of CDK9 at threonine 29 (T29) in the HIV transcription initiation complex, inhibiting CDK9 kinase activity.
18500820 The two bromodomains of Brd4 are mainly monomeric in solution; therefore Brd4 should have its own mechanism to reinforce its association with chromatin both in mitotic retention and related cellular processes.
18039861 while the P-TEFb level remains constant, the Brd4-P-TEFb interaction increases dramatically in cells progressing from late mitosis to early G(1).
17934517 BRD-NUT fusion proteins contribute to carcinogenesis by associating with chromatin and interfering with epithelial differentiation.
17690245 Overexpression of the BRD4 P-TEFb-interacting domain disrupts the interaction between the HIV transactivator Tat and positive transcription elongation factor b and suppresses the ability of Tat to transactivate the HIV promoter
17690245 The RxL or KxL motif and the polybasic cluster of HIV-1 Tat and BRD4 exhibit similar importance for P-TEFb activation
17686863 Tax may compete and functionally substitute for Brd4 in P-TEFb regulation.Tax and Brd4 compete for binding to P-TEFb through direct interaction with cyclin T1
17626100 evidence for a Brd4-independent mechanism of E2-mediated repression and suggests that different cellular factors must be involved in E2-mediated transcriptional activation and repression functions.
17189190 We show the X-ray crystal structure of the carboxy-terminal domain of Brd4 in complex with HPV-16 E2, and with this information have developed a Brd4-Tat fusion protein that is efficiently taken up by different transformed cells harboring HPV plasmids.
17023018 The major papillomavirus E2-binding protein was identified by mass spectrometry and western blotting as the long isoform of Brd4.[Brd4]
16940503 there are distinct functional roles for the two bromodomain proteins RING3/Brd2 and Brd4 in LANA binding
16921027 Brd4 is a component of human papillomavirus-assembled transcriptional silencing complex with a novel function as a cellular cofactor modulating viral gene expression.
16611886 establish a broader role for Brd4 in the papillomavirus life cycle than as the chromosome tether for papillomavirus E2 during mitosis
15994877 Wild type Brd4 inhibits G(1) to S progression and we also found that the Brd4-NUT fusion augments the inhibition of progression to S phase compared with wild type Brd4.
15795266 Brd4 has recently been proposed to mediate the association between bovine papilomavirus1 E2 and mitotic chromosomes.
15456879 Data identif a Rap GTPase-activating protein, signal-induced proliferation-associated protein 1 (SPA-1), as a factor that interacts with Brd4.
15109495 E2 protein interacts with Brd4 and tethers the viral DNA to the host mitotic chromosomes.
12192049 brd4 binds to replication factor C and inhibits progression to S phase

AA Sequence

MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVV      1 - 70
LKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYN     71 - 140
KPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQT    141 - 210
PQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQ    211 - 280
PVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKV    281 - 350
SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA    351 - 420
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSS    421 - 490
DSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEEN    491 - 560
KKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKL    561 - 630
GRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS    631 - 700
SESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPP    701 - 770
QQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP    771 - 840
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQ    841 - 910
VLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPP    911 - 980
QPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHK    981 - 1050
SDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPII   1051 - 1120
RSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAP   1121 - 1190
KKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM   1191 - 1260
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARK   1261 - 1330
REQERRRREAMAATIDMNFQSDLLSIFEENLF                                         1331 - 1362
//

Text Mined References (146)

PMID Year Title
26858406 2016 Structure of the Brd4 ET domain bound to a C-terminal motif from ?-retroviral integrases reveals a conserved mechanism of interaction.
26855180 2016 Super enhancers at the miR-146a and miR-155 genes contribute to self-regulation of inflammation.
26752646 2016 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer.
26707881 2016 Inhibition of BRD4 suppresses tumor growth and enhances iodine uptake in thyroid cancer.
26626481 2015 NSD3-Short Is an Adaptor Protein that Couples BRD4 to the CHD8 Chromatin Remodeler.
26504077 2016 Kinetically Defined Mechanisms and Positions of Action of Two New Modulators of Glucocorticoid Receptor-regulated Gene Induction.
26365679 2016 Failure to interact with Brd4 alters the ability of HPV16 E2 to regulate host genome expression and cellular movement.
26324948 2016 Bromodomain and extra-terminal domain bromodomain inhibition prevents synovial inflammation via blocking I?B kinase-dependent NF-?B activation in rheumatoid fibroblast-like synoviocytes.
26224795 2015 Bromodomain-Containing Protein 4: The Epigenetic Origin of Pulmonary Arterial Hypertension.
26220994 2015 The oncogenic BRD4-NUT chromatin regulator drives aberrant transcription within large topological domains.
26119939 2016 Immunomodulatory drugs target IKZF1-IRF4-MYC axis in primary effusion lymphoma in a cereblon-dependent manner and display synergistic cytotoxicity with BRD4 inhibitors.
26111795 2015 The Bromodomain protein BRD4 controls HOTAIR, a long noncoding RNA essential for glioblastoma proliferation.
26093279 2015 Targeting bromodomain-containing protein 4 (BRD4) benefits rheumatoid arthritis.
26083714 2015 Compensatory induction of MYC expression by sustained CDK9 inhibition via a BRD4-dependent mechanism.
26044852 2015 IL-10 disrupts the Brd4-docking sites to inhibit LPS-induced CXCL8 and TNF-? expression in monocytes: Implications for chronic obstructive pulmonary disease.
25941994 2015 Disruption of BRD4 at H3K27Ac-enriched enhancer region correlates with decreased c-Myc expression in Merkel cell carcinoma.
25892415 2015 Histo-genomic stratification reveals the frequent amplification/overexpression of CCNE1 and BRD4 genes in non-BRCAness high grade ovarian carcinoma.
25891802 2015 Suppression of interferon ? gene transcription by inhibitors of bromodomain and extra-terminal (BET) family members.
25877301 2015 Therapeutic targeting of BET bromodomain protein, Brd4, delays cyst growth in ADPKD.
25788266 2015 H4K12ac is regulated by estrogen receptor-alpha and is associated with BRD4 function and inducible transcription.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25694599 2015 Evidence supporting a role for TopBP1 and Brd4 in the initiation but not continuation of human papillomavirus 16 E1/E2-mediated DNA replication.
25656449 2015 BRAD4 plays a critical role in germinal center response by regulating Bcl-6 and NF-?B activation.
25647019 2015 BRD4 promotes pancreatic ductal adenocarcinoma cell proliferation and enhances gemcitabine resistance.
25512383 2015 Mechanistic analysis of the role of bromodomain-containing protein 4 (BRD4) in BRD4-NUT oncoprotein-induced transcriptional activation.
25506891 2015 Twist-BRD4 complex: potential drug target for basal-like breast cancer.
25340539 2014 Phosphorylation of HPV-16 E2 at serine 243 enables binding to Brd4 and mitotic chromosomes.
25284786 2014 Transformation resistance in a premature aging disorder identifies a tumor-protective function of BRD4.
25263550 2014 Control of embryonic stem cell identity by BRD4-dependent transcriptional elongation of super-enhancer-associated pluripotency genes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25140737 2014 The cellular bromodomain protein Brd4 has multiple functions in E2-mediated papillomavirus transcription activation.
25120803 2014 Bromodomain 4 protein is a predictor of survival for urothelial carcinoma of bladder.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25049379 2014 Blockade of oncogenic I?B kinase activity in diffuse large B-cell lymphoma by bromodomain and extraterminal domain protein inhibitors.
25017071 2014 Bromodomain protein BRD4 is required for estrogen receptor-dependent enhancer activation and gene transcription.
24939842 2014 Histone cross-talk connects protein phosphatase 1? (PP1?) and histone deacetylase (HDAC) pathways to regulate the functional transition of bromodomain-containing 4 (BRD4) for inducible gene expression.
24832099 2014 Papillomavirus genomes associate with BRD4 to replicate at fragile sites in the host genome.
24796395 2014 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma.
24763052 2014 The bromodomain protein BRD4 regulates the KEAP1/NRF2-dependent oxidative stress response.
24733848 2014 Bromodomain and extraterminal proteins suppress NF-E2-related factor 2-mediated antioxidant gene expression.
24664238 2014 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding.
24646477 2014 Selective inhibition of BET bromodomain epigenetic signalling interferes with the bone-associated tumour vicious cycle.
24584072 2014 An epigenetic mechanism of resistance to targeted therapy in T cell acute lymphoblastic leukemia.
24525235 2014 Disrupting the interaction of BRD4 with diacetylated Twist suppresses tumorigenesis in basal-like breast cancer.
24497639 2014 Affinity map of bromodomain protein 4 (BRD4) interactions with the histone H4 tail and the small molecule inhibitor JQ1.
24448221 2014 Brd4-mediated nuclear retention of the papillomavirus E2 protein contributes to its stabilization in host cells.
24445267 2014 Role of BRD4 in hematopoietic differentiation of embryonic stem cells.
24403256 2013 BRD4 associates with p53 in DNMT3A-mutated leukemia cells and is implicated in apoptosis by the bromodomain inhibitor JQ1.
24360279 2013 Brd4 and JMJD6-associated anti-pause enhancers in regulation of transcriptional pause release.
24297863 2014 BET bromodomain inhibition of MYC-amplified medulloblastoma.
24278023 2013 Brd4 is displaced from HPV replication factories as they expand and amplify viral DNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260471 2013 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
24189064 2013 Bromodomain and extraterminal (BET) protein inhibition suppresses human T cell leukemia virus 1 (HTLV-1) Tax protein-mediated tumorigenesis by inhibiting nuclear factor ?B (NF-?B) signaling.
24146614 2013 A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins.
24100334 2013 Different orientations of low-molecular-weight fragments in the binding pocket of a BRD4 bromodomain.
24090311 2013 Discovery of novel small-molecule inhibitors of BRD4 using structure-based virtual screening.
24049186 2013 Bromo- and extraterminal domain chromatin regulators serve as cofactors for murine leukemia virus integration.
23818621 2013 BET proteins promote efficient murine leukemia virus integration at transcription start sites.
23728299 2013 The bromodomain protein Brd4 insulates chromatin from DNA damage signalling.
23722886 2013 Current understanding of the role of the Brd4 protein in the papillomavirus lifecycle.
23686307 2014 Brd4 maintains constitutively active NF-?B in cancer cells by binding to acetylated RelA.
23589332 2013 BRD4 coordinates recruitment of pause release factor P-TEFb and the pausing complex NELF/DSIF to regulate transcription elongation of interferon-stimulated genes.
23530754 2013 Fragment-based drug discovery of 2-thiazolidinones as inhibitors of the histone reader BRD4 bromodomain.
23517011 2013 Optimization of 3,5-dimethylisoxazole derivatives as potent bromodomain ligands.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23365439 2013 Recruitment of Brd4 to the human papillomavirus type 16 DNA replication complex is essential for replication of viral DNA.
23317504 2013 Phospho switch triggers Brd4 chromatin binding and activator recruitment for gene-specific targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144621 2012 Bromodomain protein Brd4 plays a key role in Merkel cell polyomavirus DNA replication.
23128391 2013 Novel BRD4-NUT fusion isoforms increase the pathogenic complexity in NUT midline carcinoma.
23115324 2013 BET bromodomain proteins mediate downstream signaling events following growth factor stimulation in human lung fibroblasts and are involved in bleomycin-induced pulmonary fibrosis.
23095041 2012 Identification of a chemical probe for bromo and extra C-terminal bromodomain inhibition through optimization of a fragment-derived hit.
23086925 2012 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells.
23041316 2012 Reactivation of latent HIV-1 by inhibition of BRD4.
23027873 2012 Cross-talk among RNA polymerase II kinases modulates C-terminal domain phosphorylation.
22645123 2012 Down-regulation of NF-?B transcriptional activity in HIV-associated kidney disease by BRD4 inhibition.
22509028 2012 BRD4 is an atypical kinase that phosphorylates serine2 of the RNA polymerase II carboxy-terminal domain.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
22334664 2012 Bromodomain protein Brd4 associated with acetylated chromatin is important for maintenance of higher-order chromatin structure.
22137933 2012 Benzodiazepines and benzotriazepines as protein interaction inhibitors targeting bromodomains of the BET family.
22136404 2012 Fragment-based discovery of bromodomain inhibitors part 1: inhibitor binding modes and implications for lead discovery.
22120039 2012 Aberrant epigenetic regulation of bromodomain BRD4 in human colon cancer.
22084242 2012 Two-pronged binding with bromodomain-containing protein 4 liberates positive transcription elongation factor b from inactive ribonucleoprotein complexes.
22035730 2012 Expression of BET genes in testis of men with different spermatogenic impairments.
21964340 2011 Inhibition of BET recruitment to chromatin as an effective treatment for MLL-fusion leukaemia.
21890894 2011 Signal-induced Brd4 release from chromatin is essential for its role transition from chromatin targeting to transcriptional regulation.
21652721 2011 Perturbation of BRD4 protein function by BRD4-NUT protein abrogates cellular differentiation in NUT midline carcinoma.
21568322 2011 Discovery and characterization of small molecule inhibitors of the BET family bromodomains.
21555454 2011 The Brd4 extraterminal domain confers transcription activation independent of pTEFb by recruiting multiple proteins, including NSD3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21068722 2010 Suppression of inflammation by a synthetic histone mimic.
20871596 2010 Selective inhibition of BET bromodomains.
20676058 2010 Oncogenesis by sequestration of CBP/p300 in transcriptionally inactive hyperacetylated chromatin domains.
20201073 2010 T-loop phosphorylated Cdk9 localizes to nuclear speckle domains which may serve as sites of active P-TEFb function and exchange between the Brd4 and 7SK/HEXIM1 regulatory complexes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20036832 2010 WHAT do viruses BET on?
19846528 2010 Abrogation of the Brd4-positive transcription elongation factor B complex by papillomavirus E2 protein contributes to viral oncogene repression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19596781 2009 Regulation of aurora B expression by the bromodomain protein Brd4.
19596240 2009 Control of inducible gene expression by signal-dependent transcriptional elongation.
19553317 2009 Brd4 regulation of papillomavirus protein E2 stability.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19211738 2009 Proteasomal degradation of the papillomavirus E2 protein is inhibited by overexpression of bromodomain-containing protein 4.
19129460 2009 Papillomavirus E2 proteins and the host BRD4 protein associate with transcriptionally active cellular chromatin.
19103749 2009 Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA.
19038968 2009 Chromatin adaptor Brd4 modulates E2 transcription activity and protein stability.
18971272 2009 Bromodomain protein Brd4 regulates human immunodeficiency virus transcription through phosphorylation of CDK9 at threonine 29.
18922874 2008 The EBNA1 protein of Epstein-Barr virus functionally interacts with Brd4.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18500820 2008 Structural basis and binding properties of the second bromodomain of Brd4 with acetylated histone tails.
18305892 2008 Search for cellular partners of human papillomavirus type 16 E2 protein.
18039861 2008 Brd4 recruits P-TEFb to chromosomes at late mitosis to promote G1 gene expression and cell cycle progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17934517 2008 BRD-NUT oncoproteins: a family of closely related nuclear proteins that block epithelial differentiation and maintain the growth of carcinoma cells.
17690245 2007 Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription.
17686863 2007 Modulation of the Brd4/P-TEFb interaction by the human T-lymphotropic virus type 1 tax protein.
17626100 2007 Brd4-independent transcriptional repression function of the papillomavirus e2 proteins.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17189190 2006 Structure of the papillomavirus DNA-tethering complex E2:Brd4 and a peptide that ablates HPV chromosomal association.
17189189 2006 ChlR1 is required for loading papillomavirus E2 onto mitotic chromosomes and viral genome maintenance.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17023018 2007 Amino acid substitutions that specifically impair the transcriptional activity of papillomavirus E2 affect binding to the long isoform of Brd4.
16940503 2006 Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen interacts with bromodomain protein Brd4 on host mitotic chromosomes.
16921027 2006 Brd4 links chromatin targeting to HPV transcriptional silencing.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16611886 2006 Bromodomain protein 4 mediates the papillomavirus E2 transcriptional activation function.
16109377 2005 Recruitment of P-TEFb for stimulation of transcriptional elongation by the bromodomain protein Brd4.
16109376 2005 The bromodomain protein Brd4 is a positive regulatory component of P-TEFb and stimulates RNA polymerase II-dependent transcription.
15994877 2005 Cloned fusion product from a rare t(15;19)(q13.2;p13.1) inhibit S phase in vitro.
15795266 2005 The mitotic chromosome binding activity of the papillomavirus E2 protein correlates with interaction with the cellular chromosomal protein, Brd4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456879 2004 Bromodomain protein Brd4 binds to GTPase-activating SPA-1, modulating its activity and subcellular localization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15109495 2004 Interaction of the bovine papillomavirus E2 protein with Brd4 tethers the viral DNA to host mitotic chromosomes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12543779 2003 BRD4-NUT fusion oncogene: a novel mechanism in aggressive carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12192049 2002 A Mammalian bromodomain protein, brd4, interacts with replication factor C and inhibits progression to S phase.
11733348 2001 BRD4 bromodomain gene rearrangement in aggressive carcinoma with translocation t(15;19).
11060498 Characterization of TRBP1 and TRBP2. Stable stem-loop structure at the 5' end of TRBP2 mRNA resembles HIV-1 TAR and is not found in its processed pseudogene.
10938129 2000 A bromodomain protein, MCAP, associates with mitotic chromosomes and affects G(2)-to-M transition.