Property Summary

Ligand Count 391
NCBI Gene PubMed Count 169
PubMed Score 1511.52
PubTator Score 236.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.796 9.3e-04
astrocytoma 2.200 4.6e-04
juvenile dermatomyositis 1.188 4.5e-10
lung cancer 1.400 4.5e-03
ovarian cancer -1.300 3.2e-04
pancreatic ductal adenocarcinoma liver m... 1.040 4.6e-02
Rheumatoid arthritis 2.700 5.3e-05
tuberculosis and treatment for 6 months -1.200 4.5e-05

Synonym

Accession O60885 O60433 Q4G0X8 Q86YS8 Q96PD3
Symbols CAP
MCAP
HUNK1
HUNKI

Gene

PDB

5T35   2NCZ   2ND1   3UVW   3UVX   3UVY   3UW9   2LSP   4KV1   4KV4   2I8N   2MJV   2N3K   2ND0   2NNU   2OSS   2OUO   2YEL   2YEM   3MXF   3P5O   3SVF   3SVG   3U5J   3U5K   3U5L   3ZYU   4A9L   4BJX   4BW1   4BW2   4BW3   4BW4   4C66   4C67   4CFK   4CFL   4CL9   4CLB   4DON   4E96   4F3I   4GPJ   4HBV   4HBW   4HBX   4HBY   4HXK   4HXL   4HXM   4HXN   4HXO   4HXP   4HXR   4HXS   4IOO   4IOQ   4IOR   4J0R   4J0S   4J3I   4LR6   4LRG   4LYI   4LYS   4LYW   4LZR   4LZS   4MEN   4MEO   4MEP   4MEQ   4MR3   4MR4   4NQM   4NR8   4NUC   4NUD   4NUE   4O70   4O71   4O72   4O74   4O75   4O76   4O77   4O78   4O7A   4O7B   4O7C   4O7E   4O7F   4OGI   4OGJ   4PCE   4PCI   4PS5   4QB3   4QR3   4QR4   4QR5   4QZS   4UIX   4UIY   4UIZ   4UYD   4WHW   4WIV   4X2I   4XY9   4XYA   4YH3   4YH4   4Z1Q   4Z1S   4Z93   4ZC9   4ZW1   5A5S   5A85   5ACY   5AD2   5AD3   5BT4   5CFW   5COI   5CP5   5CPE   5CQT   5CRM   5CRZ   5CS8   5CTL   5CY9   5D0C   5D24   5D25   5D26   5D3H   5D3J   5D3L   5D3N   5D3P   5D3R   5D3S   5D3T   5DLX   5DLZ   5DW2   5DX4   5E0R   5EGU   5EI4   5EIS   5F5Z   5F60   5F61   5F62   5F63   5FBX   5H21   5HCL   5HLS   5HM0   5HQ5   5HQ6   5HQ7   5I80   5I88   5IGK   5JWM   5KDH   5KHM   5KJ0   5KU3   5LJ1   5LJ2   5LRQ   5LUU   5M39   5M3A   5TI2   5TI3   5TI4   5TI5   5TI6   5TI7   5U28   5U2C   5U2E   5U2F   5UEO   5UEP   5UEQ   5UER   5UES   5UET   5UEU   5UEV   5UEX   5UEY   5UEZ   5UF0   5ULA   5UOO   5UVS   5UVT   5UVU   5UVV   5UVW   5UVX   5UVY   5UVZ   5VOM   5WUU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (165)

AA Sequence

MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVV      1 - 70
LKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYN     71 - 140
KPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQT    141 - 210
PQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQ    211 - 280
PVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKV    281 - 350
SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA    351 - 420
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSS    421 - 490
DSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEEN    491 - 560
KKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKL    561 - 630
GRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS    631 - 700
SESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPP    701 - 770
QQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP    771 - 840
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQ    841 - 910
VLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPP    911 - 980
QPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHK    981 - 1050
SDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPII   1051 - 1120
RSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAP   1121 - 1190
KKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM   1191 - 1260
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARK   1261 - 1330
REQERRRREAMAATIDMNFQSDLLSIFEENLF                                         1331 - 1362
//

Text Mined References (199)

PMID Year Title