Property Summary

Ligand Count 6
NCBI Gene PubMed Count 30
PubMed Score 57.37
PubTator Score 27.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 1.1e-06
ovarian cancer 8520 5.3e-05
osteosarcoma 7950 1.1e-04
group 3 medulloblastoma 4104 5.4e-03
subependymal giant cell astrocytoma 2287 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Schizophrenia 1160 3.57 1.8
Disease Target Count Z-score Confidence
Monocytic leukemia 1 3.556 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.300 5.4e-03
osteosarcoma -1.397 1.1e-04
ovarian cancer -1.400 5.3e-05
subependymal giant cell astrocytoma -1.082 4.5e-02
tuberculosis -1.700 1.1e-06

PDB (308)

Gene RIF (13)

AA Sequence

MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEIILEDDLTAQEM      1 - 70
SECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEPKVRIVEYSPPSAPRRPPVYY     71 - 140
KFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPAVSQSMFEFLMDRFEKESHCENQKQGEQQSL    141 - 210
IDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGA    211 - 280
FKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAF    281 - 350
HVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV    351 - 420
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYWLLKRLSRNGA    421 - 490
PLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIELLRKREKLKREQVKVEQVAM    491 - 560
ELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEED    561 - 630
FDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDV    631 - 700
DRLLDPANRAHLGLEEQLRELLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLE    701 - 770
GFEEDGAALGPEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL    771 - 840
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGNYAKAARIAAE    841 - 910
VGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQT    911 - 980
KSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEP    981 - 1050
TSDLSDID                                                                 1051 - 1058
//

Text Mined References (39)

PMID Year Title