Property Summary

NCBI Gene PubMed Count 34
PubMed Score 13.43
PubTator Score 21.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVR      1 - 70
IVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQA     71 - 140
MYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYE    141 - 210
RIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVS    211 - 280
GPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE                                      281 - 316
//

Text Mined References (41)

PMID Year Title