Property Summary

NCBI Gene PubMed Count 1,615
PubMed Score 199.07
PubTator Score 4341.62

Knowledge Summary

Patent (172,202)

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.04553501164785E-8
glioblastoma 5572 9.60415674942511E-8
tuberculosis 1563 3.92393658260884E-7
pediatric high grade glioma 2712 1.46701065999577E-6
medulloblastoma, large-cell 6234 1.25628103770268E-5
interstitial cystitis 2299 1.63451565969272E-5
osteosarcoma 7933 2.93835331934866E-5
psoriasis 6685 3.49270545882038E-4
astrocytic glioma 2241 0.0130006401377678
oligodendroglioma 2849 0.0143975321927216
subependymal giant cell astrocytoma 2287 0.0311319860270308
ependymoma 2514 0.0356863989940804
spina bifida 1064 0.0414053479524123
Disease Target Count Z-score Confidence
Erdheim-Chester disease 5 3.943 2.0
Langerhans-cell histiocytosis 11 3.545 1.8
Disease Target Count Z-score Confidence
Cancer 2346 4.356 2.2
Cardiomyopathy 110 0.0 4.0
Intellectual disability 573 0.0 4.0
Disease Target Count
Familial non-Hodgkin lymphoma 2

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.200 0.013
ependymoma -1.200 0.036
oligodendroglioma -1.200 0.014
psoriasis -1.800 0.000
osteosarcoma -1.451 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.400 0.000
tuberculosis -2.000 0.000
interstitial cystitis -1.500 0.000
pediatric high grade glioma -1.200 0.000
subependymal giant cell astrocytoma -1.912 0.031
spina bifida -2.027 0.041
ovarian cancer 1.400 0.000

Synonym

Accession P15056 A4D1T4 B6HY61 B6HY62 B6HY63 B6HY64 B6HY65 B6HY66 Q13878 Q3MIN6 Q9UDP8 Q9Y6T3
Symbols NS7
B-raf
BRAF1
RAFB1
B-RAF1

Gene

PDB

1UWH   1UWJ   2FB8   2L05   3C4C   3D4Q   3IDP   3II5   3NY5   3OG7   3PPJ   3PPK   3PRF   3PRI   3PSB   3PSD   3Q4C   3Q96   3SKC   3TV4   3TV6   4CQE   4DBN   4E26   4E4X   4EHE   4EHG   4FC0   4FK3   4G9C   4G9R   4H58   4JVG   4KSP   4KSQ   4MBJ   4MNE   4MNF   4PP7   4R5Y   4RZV   4RZW   4WO5   4XV1   4XV2   4XV3   4XV9   4YHT   5C9C   5CSW   5CSX   5CT7   5FD2   5HI2   5HID   5HIE   5ITA   5J18   5J2R   5JSM   5JT2  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (1644)

PMID Text
27094161 New and highly sensitive method to detect BRAF V600 mutations in Langerhans cell histiocytosis.
27082577 The BRAF-mutated Colorectal Cancers ,in comparison to KRAS-mutated ones, are associated with a much worse prognosis for the afflicted patients.
27064992 the prevalence and clinicopathological associations of BRAF V600E and TERT promoter mutations in Chinese PTC patients
26997442 Low incidence of BRAF mutations in adenocarcinomas of the ampulla of Vater suggest no major role in tumorigenesis.
26997441 BRAF inhibitor therapy-associated melanocytic lesions lack the BRAF V600E mutation and show increased levels of cyclin D1 expression.
26996308 beta3-alphaC deletions are activating mutations in BRAF. BRAF deltaNVTAP confers CRAF- and dimer-independent activity and is resistant to vemurafenib.
26945035 This study demonstrated that when whole chromosome 7 gain accompanies the KIAA1549-BRAF fusion, the fusion likely arises first.
26927026 BRAF V600E mutations were found in the papillary craniopharyngiomas subgroup and were not detectable in papillary craniopharyngiomas samples.
26924424 BRAF-V600E expression in primary nodular melanoma is associated with aggressive tumour features.
26912807 BRAF V600E mutation predisposes papillary thyroid carcinoma cells toward invasive phenotypes
More...

AA Sequence

MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGG      1 - 70
EHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQN     71 - 140
PTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGW    141 - 210
DTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMC    211 - 280
VNYDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPAD    281 - 350
EDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSP    351 - 420
GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAP    421 - 490
TPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQT    491 - 560
AQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDK    561 - 630
NPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKK    631 - 700
RDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH        701 - 766
//

Text Mined References (1626)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
27094161 2016 BRAF V600 mutations in Langerhans cell histiocytosis with a simple and unique assay.
27082577 2016 MicroRNA Expression Signatures Associated With BRAF-Mutated Versus KRAS-Mutated Colorectal Cancers.
27064992 2016 BRAF V600E and TERT Promoter Mutations in Papillary Thyroid Carcinoma in Chinese Patients.
26997442 2016 Low incidence of KRAS, BRAF, and PIK3CA mutations in adenocarcinomas of the ampulla of Vater and their prognostic value.
26997441 2016 BRAF inhibitor therapy-associated melanocytic lesions lack the BRAF V600E mutation and show increased levels of cyclin D1 expression.
26996308 2016 Activation Mechanism of Oncogenic Deletion Mutations in BRAF, EGFR, and HER2.
26945035 2016 Whole Chromosome 7 Gain Predicts Higher Risk of Recurrence in Pediatric Pilocytic Astrocytomas Independently From KIAA1549-BRAF Fusion Status.
26927026 2016 Adamantinomatous and papillary craniopharyngiomas are characterized by distinct epigenomic as well as mutational and transcriptomic profiles.
26924424 2016 BRAF-V600E expression in primary nodular melanoma is associated with aggressive tumour features and reduced survival.
More...