Property Summary

NCBI Gene PubMed Count 54
PubMed Score 191.46
PubTator Score 106.78

Knowledge Summary

Patent (19,518)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.489 6.1e-03
non-small cell lung cancer -1.085 1.3e-16
breast carcinoma -1.200 1.3e-05
lung adenocarcinoma -1.400 4.1e-08
invasive ductal carcinoma -1.100 1.7e-02
ovarian cancer 1.100 2.2e-07

Protein-protein Interaction (11)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (32)

PMID Text
25649765 BMX directly inhibits a core component of the intrinsic apoptosis machinery opens opportunities to improve the efficacy of existing chemotherapy by potentiating BAK-driven cell death in cancer cells.
25499959 Report BMX-ARHGAP gene fusion in gastric cardia adenocarcinoma.
24860816 These findings suggested that polymorphisms of the BMX gene could be a potential predictor of clinical symptoms following mTBI.
24785188 The effects of dietary K(+) on Bmx were more pronounced
24722985 A cell-based bimolecular fluorescence complementation assay demonstrates that HIV-1 Nef interacts with the Tec family members Bmx, Btk, and Itk, but not with Tec or Txk in 293T cells
24709422 BMX is an antiapoptotic downstream effector of PI3K, independent of AKT.
24606948 Overexpression of ETK is associated with the malignancy and disease progression of renal cell carcinoma.
22449076 This review characterizes the role of BMX in inflamamtion, cardiovascular disease and cancer.
21481791 Constitutively active STAT3 rescued the effects of BMX downregulation, supporting that BMX signals through STAT3 in glioblastoma stem cells (GSCs).
21471444 study concludes that BMX is an essential component of inflammatory cytokine signaling and that catalytic, as well as noncatalytic functions of BMX are involved
21408190 Deregulation of ETK may attribute to the elevated activity of STAT3 and AKT frequently detected in bladder cancer.
21339702 Etk/BMX may play a role in protection of NPC cells from apoptosis.
20864667 Investigate Bmx mediates VEGF-dependent lymphangiogenic signaling.
20559570 by preventing binding of Etk/Bmx to PAR(1) -C-tail, hPar1 oncogenic properties are abrogated
20206622 high expression of Etk occurs in 74.6% of SCLC cases, but only in 40% of NSCLC cases, and there is marked difference in the expression levels of Bcl-2, Bcl-X(L) and p53 between Etk-positive and Etk-negative SCLC cases
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19951526 BMX is associated with multi-drug resistance of K562/HHT cell line.
19464057 Observational study of gene-disease association. (HuGE Navigator)
18413754 Pretreatment of umbilical vein cells with a pharmacologic inhibitor of Bmx, LFM-A13, produced significant radiosensitization of endothelial cells measured by clonogenic survival analysis and apoptosis.
18402776 Bmx kinase activity in fibroblasts from rheumatoid synovium is increased following LPS stimulation; Bmx is involved in the regulation of LPS-induced IL-6 and VEGF production via mRNA stabilisation.
18292575 In fibroblast-like synoviocytes of rheumatoid arthritis patients, Etk is implicated in the cross-talk between focal adhesion kinase (FAK) and myeloid differentiation factor 88 (MyD88) pathways.
18196928 Etk/Bmx may have different biological roles in tumor and nontumor cells, and may be involved in regulating hepatocyte differentiation by c-Fos activation in HCC.
18025155 Mechanisms regulating IL-6 production led to the discovery that the Tec kinase bone marrow tyrosine kinase gene in chromosome X (Bmx) regulates Toll-like receptor 4-induced IL-6 production.
17823122 results demonstrate that Bmx is a critical downstream target of the constitutively active PI 3-kinase in PTEN-deficient PCa cells and further show that Bmx is recruited by the EGF receptor and ErbB3 and activated in response to their respective ligands
16932810 Role of Bmx in ischemia-mediated arteriogenesis/angiogenesis: response to ischemia, enhanced in transgenic mice.
16912182 Etk transgenic mouse model may be a useful tool for studying the functions of Etk and identification of new molecular markers and drug targets relevant to human diseases.
16186805 two isoforms of Pim-1 kinase may regulate distinct substrates and the 44 kDa Pim-1 may play a more prominent role in drug resistance in prostate cancer cells and interact directly with tyrosine kinase Etk/BMX
15207703 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
14981536 Pim1 and Etk are required for IL6-induced activation of androgen receptor-mediated transcription in prostate cancer.
14676838 Etk activation is essential for transducing the EGF-induced apoptotic signaling in breast cancer cells.
12370298 BMX/Etk is a TNFR2-specific kinase involved in TNF-induced angiogenic events
11877430 possible role in regulation of vesicle trafficking

AA Sequence

MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE      1 - 70
QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA     71 - 140
PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS    141 - 210
TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP    211 - 280
ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH    281 - 350
VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL    351 - 420
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE    421 - 490
YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY    491 - 560
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR    561 - 630
LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH                             631 - 675
//

Text Mined References (61)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25649765 2015 BMX Negatively Regulates BAK Function, Thereby Increasing Apoptotic Resistance to Chemotherapeutic Drugs.
25499959 2014 Identification of a novel gene fusion (BMX-ARHGAP) in gastric cardia adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24860816 2014 The influence of BMX gene polymorphisms on clinical symptoms after mild traumatic brain injury.
24785188 2014 Sodium and potassium regulate endothelial phospholipase C-? and Bmx.
24709422 2014 BMX acts downstream of PI3K to promote colorectal cancer cell survival and pathway inhibition sensitizes to the BH3 mimetic ABT-737.
24606948 2014 The expression and role of tyrosine kinase ETK/BMX in renal cell carcinoma.
22449076 2012 BMX and its role in inflammation, cardiovascular disease, and cancer.
21481791 2011 Nonreceptor tyrosine kinase BMX maintains self-renewal and tumorigenic potential of glioblastoma stem cells by activating STAT3.
21471444 2011 The tyrosine kinase BMX is an essential mediator of inflammatory arthritis in a kinase-independent manner.
21408190 2011 Tyrosine kinase ETK/BMX is up-regulated in bladder cancer and predicts poor prognosis in patients with cystectomy.
21339702 2011 Tyrosine kinase Etk/BMX protects nasopharyngeal carcinoma cells from apoptosis induced by radiation.
20864667 2010 Functional analyses of the bone marrow kinase in the X chromosome in vascular endothelial growth factor-induced lymphangiogenesis.
20559570 2010 Etk/Bmx regulates proteinase-activated-receptor1 (PAR1) in breast cancer invasion: signaling partners, hierarchy and physiological significance.
20206622 2010 Non-receptor tyrosine kinase Etk is involved in the apoptosis of small cell lung cancer cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19951526 2009 [Changes of gene expression profile in homoharringtonine-induced leukemia multi-drug resistant cell line K562/HHT].
19464057 2009 A high-throughput candidate gene mutation screen in lymphoproliferative and myeloproliferative neoplasias.
18413754 2008 Bone marrow X kinase-mediated signal transduction in irradiated vascular endothelium.
18402776 2008 Bmx regulates LPS-induced IL-6 and VEGF production via mRNA stability in rheumatoid synovial fibroblasts.
18292575 2008 Etk/BMX, a Btk family tyrosine kinase, and Mal contribute to the cross-talk between MyD88 and FAK pathways.
18196928 2007 Expression of tyrosine kinase Etk/Bmx and its relationship with AP-1- and NF-kappaB-associated proteins in hepatocellular carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025155 2008 Bmx tyrosine kinase regulates TLR4-induced IL-6 production in human macrophages independently of p38 MAPK and NFkapp}B activity.
17823122 2007 Activation of nonreceptor tyrosine kinase Bmx/Etk mediated by phosphoinositide 3-kinase, epidermal growth factor receptor, and ErbB3 in prostate cancer cells.
17624943 2007 Tec kinases, actin, and cell adhesion.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16932810 2006 Critical function of Bmx/Etk in ischemia-mediated arteriogenesis and angiogenesis.
16912182 2006 Tyrosine kinase Etk/BMX is up-regulated in human prostate cancer and its overexpression induces prostate intraepithelial neoplasia in mouse.
16186805 2006 The 44 kDa Pim-1 kinase directly interacts with tyrosine kinase Etk/BMX and protects human prostate cancer cells from apoptosis induced by chemotherapeutic drugs.
15788485 2005 Etk/Bmx mediates expression of stress-induced adaptive genes VEGF, PAI-1, and iNOS via multiple signaling cascades in different cell systems.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15207703 2004 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
14981536 2004 Synergism of cytoplasmic kinases in IL6-induced ligand-independent activation of androgen receptor in prostate cancer cells.
14676838 2004 The role of tyrosine kinase Etk/Bmx in EGF-induced apoptosis of MDA-MB-468 breast cancer cells.
14532277 2003 Etk/Bmx transactivates vascular endothelial growth factor 2 and recruits phosphatidylinositol 3-kinase to mediate the tumor necrosis factor-induced angiogenic pathway.
12832404 2003 p130Cas Couples the tyrosine kinase Bmx/Etk with regulation of the actin cytoskeleton and cell migration.
12573241 2003 Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370298 2002 Etk/Bmx as a tumor necrosis factor receptor type 2-specific kinase: role in endothelial cell migration and angiogenesis.
11877430 2002 Interaction between tyrosine kinase Etk and a RUN domain- and FYVE domain-containing protein RUFY1. A possible role of ETK in regulation of vesicle trafficking.
11751885 2002 Functional interaction of caveolin-1 with Bruton's tyrosine kinase and Bmx.
11382770 2001 Etk/Bmx tyrosine kinase activates Pak1 and regulates tumorigenicity of breast cancer cells.
11340625 2001 The Tec family of cytoplasmic tyrosine kinases: mammalian Btk, Bmx, Itk, Tec, Txk and homologs in other species.
11331870 2001 Regulation of the PH-domain-containing tyrosine kinase Etk by focal adhesion kinase through the FERM domain.
11278797 2001 Proteolytic activation of ETK/Bmx tyrosine kinase by caspases.
11114746 2000 Signaling network of the Btk family kinases.
11013262 2000 Protein-tyrosine phosphatase D1, a potential regulator and effector for Tec family kinases.
10962576 2000 The Bmx tyrosine kinase is activated by IL-3 and G-CSF in a PI-3K dependent manner.
10688651 2000 Etk, a Btk family tyrosine kinase, mediates cellular transformation by linking Src to STAT3 activation.
10196179 1999 Phosphatidylinositol 3-kinase-dependent membrane association of the Bruton's tyrosine kinase pleckstrin homology domain visualized in single living cells.
9520419 1998 Etk/Bmx, a tyrosine kinase with a pleckstrin-homology domain, is an effector of phosphatidylinositol 3'-kinase and is involved in interleukin 6-induced neuroendocrine differentiation of prostate cancer cells.
9373245 1997 The Bmx tyrosine kinase induces activation of the Stat signaling pathway, which is specifically inhibited by protein kinase Cdelta.
9323053 1997 Bmx tyrosine kinase is specifically expressed in the endocardium and the endothelium of large arteries.
8790141 1996 BMX tyrosine kinase gene is expressed in granulocytes and myeloid leukaemias.
8650201 1996 A tyrosine kinase profile of prostate carcinoma.
7970727 1994 BMX, a novel nonreceptor tyrosine kinase gene of the BTK/ITK/TEC/TXK family located in chromosome Xp22.2.