Property Summary

NCBI Gene PubMed Count 15
PubMed Score 140.79
PubTator Score 13.85

Knowledge Summary

Patent (2,718)

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.800 2.9e-02
adult high grade glioma 1.200 1.1e-02
astrocytic glioma 1.700 2.6e-03
atypical teratoid / rhabdoid tumor 1.200 3.9e-03
Breast cancer -1.200 8.0e-08
ependymoma 1.300 1.3e-02
glioblastoma 1.200 4.6e-04
interstitial cystitis 1.400 8.4e-03
intraductal papillary-mucinous carcinoma... 1.100 3.8e-02
malignant mesothelioma -1.600 3.1e-06
oligodendroglioma 1.100 4.6e-02
osteosarcoma -1.966 1.4e-03
ovarian cancer 1.700 2.7e-05
primary Sjogren syndrome 1.100 3.2e-03
psoriasis -1.200 1.6e-04
subependymal giant cell astrocytoma 1.917 7.7e-03

Gene RIF (7)

AA Sequence

MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRT      1 - 70
HGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVN     71 - 140
QMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQ    141 - 210
KDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTI    211 - 280
PDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARK    281 - 350
SQIKARITDTIGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE    351 - 420
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQQQQQQQHHHH    421 - 490
HHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQA    491 - 560
SPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGED    561 - 630
NFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSIN    631 - 700
QENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQG    701 - 770
DFNDDDTEPENLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA    771 - 840
QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTKAPFSKKVNVQ    841 - 910
ECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFDEITGSQQQKVKQRSLQKLSS    911 - 980
RQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARRHKKVGRRDSQSSNEFLTISDSKENISVALT    981 - 1050
DGKDRGNVLQPEESLLDPFGAKPFHSPDLSWHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKM   1051 - 1120
DDFGAVPFTELVVQSITPHQSQQSQPVELDPFGAAPFPSKQ                                1121 - 1161
//

Text Mined References (26)

PMID Year Title