Property Summary

NCBI Gene PubMed Count 43
PubMed Score 173.61
PubTator Score 76.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 2.995 1.7e-03
active ulcerative colitis 2.551 4.6e-03
acute myeloid leukemia -2.500 6.0e-03
Barrett's esophagus -1.200 2.6e-02
esophageal adenocarcinoma -1.600 2.1e-02
Gaucher disease type 1 -1.100 4.7e-02
group 3 medulloblastoma 1.400 6.7e-03
lung cancer -1.300 3.4e-03
lung carcinoma -1.200 9.9e-22
malignant mesothelioma -3.600 4.5e-08
ovarian cancer -1.100 7.9e-07
psoriasis -1.100 3.7e-03
Systemic lupus erythematosus 1.300 2.4e-04
tuberculosis 1.700 1.4e-05

 OMIM Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (29)

AA Sequence

MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEV      1 - 70
AYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEV     71 - 140
VGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKK    141 - 210
SPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILH    211 - 280
CLGLAEEIQKYCCSRK                                                          281 - 296
//

Text Mined References (52)

PMID Year Title