Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 4.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.851 3.0e-05

Gene RIF (2)

AA Sequence

MASQGRRRRPLRRPETVVPGEATETDSERSASSSEEEELYLGPSGPTRGRPTGLRVAGEAAETDSEPEPE      1 - 70
PEPTAAPRDLPPLVVQRESAEEAWGTEEAPAPAPARSLLQLRLAESQARLDHDVAAAVSGVYRRAGRDVA     71 - 140
ALASRLAAAQAAGLAAAHSVRLARGDLCALAERLDIVAGCRLLPDIRGVPGTEPEKDPGPRA            141 - 202
//

Text Mined References (22)

PMID Year Title