Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.52
PubTator Score 18.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
gastric carcinoma 1.400 1.0e-02
astrocytoma 1.800 4.7e-03
osteosarcoma 2.497 3.0e-05
chronic lymphosyte leukemia 1.100 2.4e-03
posterior fossa group B ependymoma -2.100 2.2e-06
glioblastoma 1.600 2.2e-02
group 4 medulloblastoma 1.800 3.4e-04
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
medulloblastoma, large-cell 2.300 2.9e-06
primitive neuroectodermal tumor 1.500 4.7e-05
adrenocortical carcinoma 1.196 2.4e-02
non-small cell lung cancer 1.387 1.4e-11
intraductal papillary-mucinous adenoma (... 1.300 2.1e-02
intraductal papillary-mucinous carcinoma... 1.400 3.8e-02
intraductal papillary-mucinous neoplasm ... 3.300 2.8e-05
colon cancer 1.300 5.0e-02
active ulcerative colitis 1.797 1.7e-02
sarcoidosis 1.100 5.4e-03
pancreatic cancer 1.200 1.7e-04
pediatric high grade glioma 1.500 6.7e-05
primary Sjogren syndrome 1.400 9.4e-03
lung carcinoma 1.300 3.5e-18
Alzheimer's disease 1.100 2.3e-02
Pick disease 2.300 9.4e-06
Breast cancer -1.200 1.0e-04
ovarian cancer 2.400 5.6e-05

Protein-protein Interaction (7)

Gene RIF (12)

PMID Text
25792135 Graft BICD1 polymorphisms apart from the association with telomere length, affect early kidney function after transplantation
20709820 Variants in BICD1 are associated with length of telomeres, which suggests that a mechanism linked to accelerated aging may be involved in the pathogenesis of emphysema.
20709820 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20686608 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164183 the protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization
20080650 Observational study of gene-disease association. (HuGE Navigator)
18487243 BICD1 plays a similar role in telomere length homeostasis in humans.
17707369 The brain-specific Rab6B via Bicaudal-D1 is linked to the dynein/dynactin complex, suggesting a regulatory role for Rab6B in the retrograde transport of cargo in neuronal cells.
17139249 These results imply that GSK-3beta may function in transporting centrosomal proteins to the centrosome by stabilizing the BICD1 and dynein complex, resulting in the regulation of a focused microtubule organization.
17101644 findings show BICD1 localized to Chlamydia trachomatis inclusions in a biovar-specific manner and that EGFP-BICD1 is recruited to the inclusion in a microtubule- and Golgi apparatus-independent but chlamydial gene expression-dependent mechanism
16320833 Various processes in which BicD is involved during Drosophilian development (review)

AA Sequence

MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK      1 - 70
EAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDL     71 - 140
KENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEET    141 - 210
VLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPN    211 - 280
NDDKMNGHIHGPLVKLNGDYRTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQES    281 - 350
QTQLEHTKGALTEQHERVHRLTEHVNAMRGLQSSKELKAELDGEKGRDSGEEAHDYEVDINGLEILECKY    351 - 420
RVAVTEVIDLKAEIKALKEKYNKSVENYTDEKAKYESKIQMYDEQVTSLEKTTKESGEKMAHMEKELQKM    421 - 490
TSIANENHSTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGPDDPRGLLS    491 - 560
PRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKEPMNIYNLNA    561 - 630
IIRDQIKHLQKAVDRSLQLSRQRAAARELAPMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQ    631 - 700
TAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAE    701 - 770
DEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSGEASVTVPTIDTYLLHSQ    771 - 840
GPQTPNIRVSSGTQRKRQFSPSLCDQSRPRTSGASYLQNLLRVPPDPTSTESFLLKGPPSMSEFIQGHRL    841 - 910
SKEKRLTVAPPDCQQPAASVPPQCSQLAGRQDCPTVSPDTALPEEQPHSSSQCAPLHCLSKPPHP         911 - 975
//

Text Mined References (31)

PMID Year Title
25792135 2015 hTERT, BICD1 and chromosome 18 polymorphisms associated with telomere length affect kidney allograft function after transplantation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20709820 2011 Genome-wide association study identifies BICD1 as a susceptibility gene for emphysema.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20164183 2010 A novel protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization.
20089649 2010 Bicaudal D1-dependent trafficking of human cytomegalovirus tegument protein pp150 in virus-infected cells.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19851299 2010 Linkage and genome-wide association analysis of obesity-related phenotypes: association of weight with the MGAT1 gene.
19825938 2009 Dynein and kinesin regulate stress-granule and P-body dynamics.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18487243 2008 A regulatory SNP of the BICD1 gene contributes to telomere length variation in humans.
17707369 2007 A role for the Rab6B Bicaudal-D1 interaction in retrograde transport in neuronal cells.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17139249 2006 GSK-3beta-regulated interaction of BICD with dynein is involved in microtubule anchorage at centrosome.
17101644 2007 The Rab6 effector Bicaudal D1 associates with Chlamydia trachomatis inclusions in a biovar-specific manner.
16541075 2006 The finished DNA sequence of human chromosome 12.
16473624 2005 Assay and properties of rab6 interaction with dynein-dynactin complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16320833 2005 BicD-dependent localization processes: from Drosophilia development to human cell biology.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12892780 2003 Golgins in the structure and dynamics of the Golgi apparatus.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447383 2002 Bicaudal-D regulates COPI-independent Golgi-ER transport by recruiting the dynein-dynactin motor complex.
12401177 2002 The Rab6 GTPase regulates recruitment of the dynactin complex to Golgi membranes.
9367685 1997 A human homologue (BICD1) of the Drosophila bicaudal-D gene.
8530100 1995 Isolation and regional assignment of human chromosome 12p cDNAs.