Property Summary

NCBI Gene PubMed Count 21
PubMed Score 46.34
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.540 7.3e-03
Atopic dermatitis -1.200 8.6e-03
Breast cancer -1.200 9.2e-05
breast carcinoma -1.400 1.3e-05
cystic fibrosis 1.100 4.6e-02
ependymoma 2.100 4.4e-11
gastric carcinoma 2.400 1.2e-02
interstitial cystitis 1.200 1.4e-03
intraductal papillary-mucinous adenoma (... -3.800 2.7e-06
intraductal papillary-mucinous carcinoma... -3.900 7.0e-06
intraductal papillary-mucinous neoplasm ... -3.000 2.8e-03
invasive ductal carcinoma -2.000 1.1e-03
lung cancer -1.200 4.6e-03
lung carcinoma -2.500 1.7e-22
malignant mesothelioma -3.000 1.4e-08
osteosarcoma 1.794 1.4e-03
ovarian cancer -3.900 9.3e-14
pituitary cancer -2.500 2.0e-08
sonic hedgehog group medulloblastoma 1.400 2.0e-02
spina bifida -2.440 4.2e-02
ulcerative colitis 1.700 1.1e-03

Gene RIF (13)

AA Sequence

MAAQGEPGYLAAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEAMLQAAAEGKG      1 - 70
RSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVS     71 - 140
HTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFE    141 - 210
LPIAGILQPVPDPNSPSIQHISQTYNISVSFKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLA    211 - 280
SAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMG    281 - 350
CLPLVLMFDMKEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESS    351 - 420
GVTIATSPSPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSTTPNSLLNALNSSVSPLQSPSS    421 - 490
GTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQ    491 - 560
TEGKKISAALNGHAQSPDIKYGAISTSSLGEKVLSANHGDPSIQTSGSEQTSPKSSPTEGCNDAFVEVGM    561 - 630
PRSPSHSGNAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSER    631 - 700
AAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAE    701 - 770
TIKELRRANHVSYKPTMTTTYEGSSMSLSRSNSREHLGGGSESDNWRDRNGIGPGSHSEFAASIGSPKRK    771 - 840
QNKSTEHYLSSSNYMDCISSLTGSNGCNLNSSFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQ    841 - 910
DLKELGITTFGARRKMLLAISELNKNRRKLFESPNARTSFLEGGASGRLPRQYHSDIASVSGRW          911 - 974
//

Text Mined References (26)

PMID Year Title