Property Summary

NCBI Gene PubMed Count 18
PubMed Score 42.04
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -3.000 1.4e-08
osteosarcoma 1.794 1.4e-03
posterior fossa group B ependymoma 2.400 1.0e-09
Atopic dermatitis -1.200 8.6e-03
adrenocortical carcinoma -1.540 7.3e-03
intraductal papillary-mucinous adenoma (... -3.800 2.7e-06
intraductal papillary-mucinous carcinoma... -3.900 7.0e-06
intraductal papillary-mucinous neoplasm ... -3.000 2.8e-03
lung cancer -2.200 3.2e-04
breast carcinoma -1.400 1.3e-05
interstitial cystitis 1.200 1.4e-03
cystic fibrosis 1.100 4.6e-02
sonic hedgehog group medulloblastoma 1.400 2.0e-02
lung carcinoma -2.500 1.7e-22
spina bifida -2.440 4.2e-02
Breast cancer -1.200 9.2e-05
gastric carcinoma 2.400 1.2e-02
invasive ductal carcinoma -2.000 1.1e-03
ulcerative colitis 1.700 1.1e-03
ovarian cancer -3.900 9.3e-14
pituitary cancer -2.500 2.0e-08

Gene RIF (10)

PMID Text
26391493 Results provide some support for the involvement of BICC1 and PCLO in late-life depressive disorders and preliminary evidence that these genetic variants may also influence brain structural volumes
25178406 findings identify a role for increased levels of BICC1 in the pathophysiology of depressive behavior
24789909 identify Bicc1 as a genetic determinant of osteoblastogenesis and BMD and suggest that it does so by regulating Pkd2 transcript levels
24789909 Polymorphisms in intron 2 of BICC1 are associated with its expression and bone mineral density (BMD)
22910460 The minor T-allele of BICC1 has a protective role against major depressive disorder and its known structural and functional brain changes.
21922595 The nonsense mutation identified in BICC1 and associated with cystic renal dysplasia results in a complete loss of Wnt inhibitory activity. The point mutation in the SAM domain results in a 22% loss of activity.
20516156 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15465627 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAQGEPGYLAAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEAMLQAAAEGKG      1 - 70
RSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVS     71 - 140
HTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFE    141 - 210
LPIAGILQPVPDPNSPSIQHISQTYNISVSFKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLA    211 - 280
SAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMG    281 - 350
CLPLVLMFDMKEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESS    351 - 420
GVTIATSPSPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSTTPNSLLNALNSSVSPLQSPSS    421 - 490
GTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQ    491 - 560
TEGKKISAALNGHAQSPDIKYGAISTSSLGEKVLSANHGDPSIQTSGSEQTSPKSSPTEGCNDAFVEVGM    561 - 630
PRSPSHSGNAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSER    631 - 700
AAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAE    701 - 770
TIKELRRANHVSYKPTMTTTYEGSSMSLSRSNSREHLGGGSESDNWRDRNGIGPGSHSEFAASIGSPKRK    771 - 840
QNKSTEHYLSSSNYMDCISSLTGSNGCNLNSSFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQ    841 - 910
DLKELGITTFGARRKMLLAISELNKNRRKLFESPNARTSFLEGGASGRLPRQYHSDIASVSGRW          911 - 974
//

Text Mined References (23)

PMID Year Title
26391493 2016 GWAS-identified risk variants for major depressive disorder: Preliminary support for an association with late-life depressive symptoms and brain structural alterations.
25178406 2015 BICC1 expression is elevated in depressed subjects and contributes to depressive behavior in rodents.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24789909 2014 Bicc1 is a genetic determinant of osteoblastogenesis and bone mineral density.
24501278 2014 Exome sequencing identifies de novo gain of function missense mutation in KCND2 in identical twins with autism and seizures that slows potassium channel inactivation.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23322567 2013 Identification of a candidate gene for astigmatism.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22910460 2012 Effect of genetic variant in BICC1 on functional and structural brain changes in depression.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21922595 2012 Two mutations in human BICC1 resulting in Wnt pathway hyperactivity associated with cystic renal dysplasia.
20516156 2010 Genome-wide association study of major recurrent depression in the U.K. population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15465627 Association analysis of genes involved in cholesterol metabolism located within the linkage region on chromosome 10 and Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11231089 2001 Identification and expression of the mammalian homologue of Bicaudal-C.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.