Property Summary

NCBI Gene PubMed Count 12
PubMed Score 58.68
PubTator Score 19.63

Knowledge Summary

Patent (877)

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.100 8.4e-03
oligodendroglioma 3.100 4.1e-03
glioblastoma 1.600 4.0e-04
osteosarcoma -2.598 3.0e-08
juvenile dermatomyositis 1.286 1.7e-08
acute quadriplegic myopathy 2.129 3.4e-07
adult high grade glioma 2.300 7.9e-06
pilocytic astrocytoma 3.100 4.2e-10
lung carcinoma 2.600 6.1e-20

Gene RIF (4)

PMID Text
25329324 results demonstrated that Best-3 is an endogenous inhibitor of NF-kappaB signaling pathway in endothelial cells, suggesting that forced Best-3 expression may be a novel approach for the treatment of vascular inflammatory diseases.
19237432 Results provide evidence that the bestrophins are expressed in pancreatic duct cells and, more specifically, that hBest1 plays a role in the calcium activated chloride channels found in these cells.
17442670 These results suggest that an auto-inhibitory mechanism in C termini of bestrophin 3 may be universal among bestrophins investigated in the study.
12032738 identified three novel VMD2-related human genes demonstrating a high degree of conservation in their respective RFP-TM domains [VMD2L1, VMD2L2, VMD2L3]

AA Sequence

MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCD      1 - 70
RYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIF     71 - 140
RSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSL    141 - 210
MTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQ    211 - 280
FFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLA    281 - 350
AADYCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDS    351 - 420
SMFLPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSV    421 - 490
RTSPIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPG    491 - 560
GPSPQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGI    561 - 630
NIVAGSRVSSDMLYLMENLDTKETDIIELNKETEESPK                                    631 - 668
//

Text Mined References (13)

PMID Year Title
25329324 2014 Bestrophin 3 ameliorates TNF?-induced inflammation by inhibiting NF-?B activation in endothelial cells.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
19237432 2009 Bestrophin expression and function in the human pancreatic duct cell line, CFPAC-1.
17442670 2007 Activation of bestrophin Cl- channels is regulated by C-terminal domains.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12907679 2003 Structure-function analysis of the bestrophin family of anion channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032738 2002 Three novel human VMD2-like genes are members of the evolutionary highly conserved RFP-TM family.
9700209 1998 Mutations in a novel gene, VMD2, encoding a protein of unknown properties cause juvenile-onset vitelliform macular dystrophy (Best's disease).