Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.461 1.1e-02
posterior fossa group A ependymoma 1.400 7.8e-07
cystic fibrosis 1.638 6.9e-05
atypical teratoid/rhabdoid tumor 1.600 1.4e-04
primitive neuroectodermal tumor 1.400 3.6e-03
non-small cell lung cancer -1.208 1.1e-13
breast carcinoma -1.100 6.6e-07
lung adenocarcinoma -1.200 9.5e-15
Breast cancer -2.400 1.6e-06
ductal carcinoma in situ -1.400 4.1e-02
invasive ductal carcinoma -1.900 1.1e-02

Synonym

Accession Q8N7W2 Q5SYY7 Q5SYY8 Q5SYY9 Q8N5T7
Symbols C10orf30

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFSERKRSRKSQSFKLVSRDYHHEVYKIPEFSNDVNGEAKETQPIFLGDESMEIKKQITGMRRLLNDST      1 - 70
GRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQS     71 - 140
QPHPTTSSNGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTA    141 - 210
VSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDP    211 - 280
EVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIV    281 - 350
GAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTGACGGPCTV    351 - 420
LPGGSAAVTLVLQSSPQTMSQEKGQMAEPWEEQHLVLLNNLTRDRAETGALSQTSQDFKHHSFLITQVSA    421 - 490
TLHHQRGIRNFPTPGSAKSLTLHISCLSL                                             491 - 519
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.