Property Summary

NCBI Gene PubMed Count 34
PubMed Score 27.64
PubTator Score 32.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Schizophrenia 503
ovarian neoplasm 97
Disease Target Count P-value
lung carcinoma 2844 1.4e-20
malignant mesothelioma 3163 1.9e-07
lung cancer 4473 2.2e-04
primitive neuroectodermal tumor 3031 2.2e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
thrombocytopenia-absent radius syndrome 15 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 3.221 1.6
Disease Target Count
1q21.1 recurrent microdeletion 1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.400 1.9e-07
primitive neuroectodermal tumor 1.300 2.2e-04
lung cancer 1.800 2.2e-04
lung carcinoma 1.200 1.4e-20

 MGI Phenotype (1)

Gene RIF (21)

PMID Text
26844272 BCL9/9L-beta-catenin Signaling is Associated With Poor Outcome in Colorectal Cancer
26494551 findings indicate that BCL9 most likely does not harbor a common genetic variant that can increase the risk for schizophrenia in the Japanese population
26384318 BCL9 is a molecular driver of DCIS invasive progression.
26081897 PCDH10 antagonized MM cell proliferation via the downregulation of Wnt/beta-catenin/BCL-9 signaling, whereas PCDH10 repressed the expression of AKT to promote the expression of GSK3beta and then to restrain the activation of beta-catenin
24599134 MiR-30-5p downregulation occurs as a result of interaction between multiple myeloma cells and bone marrow stromal cells, which in turn enhances expression of BCL9.
24419084 By beta-catenin's association with LEF1 and BCL9-2/B9L.
23382809 we detected five SNPs in the first two genes/loci - BCL9 and C9orf5 - strongly associated with negative symptoms of schizophrenia
22914623 Inhibition of the BCL9-beta-catenin interaction and selectively suppresses oncogenic Wnt transcription.
22024689 growth factor induced proliferation mediates a neutralizing response by significantly increasing miR-30c-2* which reduces BCL9 expression and cell proliferation in SKOV-3 and OVCAR-3 cells
21383261 These findings indicate that common variations in the BCL9 gene confer risk of schizophrenia and may also be associated with bipolar disorder and major depressive disorder in the Chinese Han population.
20637214 Pygo2 PHD is the only known PHD finger that is capable of interacting simultaneously with two functional ligands, B9L and BCL9
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19738061 Findings suggest that deregulation of BCL9 is an important contributing factor to tumor progression in multiple myeloma and colon neoplasms.
19715304 The amino-terminus of the BCL9 peptide is critical for maintaining the wild-type binding affinity of the BCL9 peptide to beta-catenin.
18789482 Overexpression and altered subcellular localization of ATG16L1 protein in human oral squamous-cell carcinoma: correlation with lymphovascular invasion and lymph-node metastasis are reported.
18498752 Data show that human and Drosophila Pygo PHD fingers associate with their cognate HD1 domains from BCL9/Legless to bind specifically to the histone H3 tail methylated at lysine 4 (H3K4me).
18347063 BCL9 itself contains a transcriptional activation domain in the C terminus, which functionally synergizes in lymphoid cells with the C-terminal transactivation domain of beta-catenin.
18187620 Knockdown of B-cell CLL/lymphoma 9 (BCL9) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17052462 crystallographic analysis of how beta-catenin, BCL9, BCL9-2 and Tcf4 interact

AA Sequence

MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQPSPCDSKSGG      1 - 70
HTPKALPGPGGSMGLKNGAGNGAKGKGKRERSISADSFDQRDPGTPNDDSDIKECNSADHIKSQDSQHTP     71 - 140
HSMTPSNATAPRSSTPSHGQTTATEPTPAQKTPAKVVYVFSTEMANKAAEAVLKGQVETIVSFHIQNISN    141 - 210
NKTERSTAPLNTQISALRNDPKPLPQQPPAPANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLDRESPG    211 - 280
VENKLIPSVGSPASSTPLPPDGTGPNSTPNNRAVTPVSQGSNSSSADPKAPPPPPVSSGEPPTLGENPDG    281 - 350
LSQEQLEHRERSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGP    351 - 420
GPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQV    421 - 490
VVQQCSLQDMMVHQHGPRGVVRGPPPPYQMTPSEGWAPGGTEPFSDGINMPHSLPPRGMAPHPNMPGSQM    491 - 560
RLPGFAGMINSEMEGPNVPNPASRPGLSGVSWPDDVPKIPDGRNFPPGQGIFSGPGRGERFPNPQGLSEE    561 - 630
MFQQQLAEKQLGLPPGMAMEGIRPSMEMNRMIPGSQRHMEPGNNPIFPRIPVEGPLSPSRGDFPKGIPPQ    631 - 700
MGPGRELEFGMVPSGMKGDVNLNVNMGSNSQMIPQKMREAGAGPEEMLKLRPGGSDMLPAQQKMVPLPFG    701 - 770
EHPQQEYGMGPRPFLPMSQGPGSNSGLRNLREPIGPDQRTNSRLSHMPPLPLNPSSNPTSLNTAPPVQRG    771 - 840
LGRKPLDISVAGSQVHSPGINPLKSPTMHQVQSPMLGSPSGNLKSPQTPSQLAGMLAGPAAAASIKSPPV    841 - 910
LGSAAASPVHLKSPSLPAPSPGWTSSPKPPLQSPGIPPNHKAPLTMASPAMLGNVESGGPPPPTASQPAS    911 - 980
VNIPGSLPSSTPYTMPPEPTLSQNPLSIMMSRMSKFAMPSSTPLYHDAIKTVASSDDDSPPARSPNLPSM    981 - 1050
NNMPGMGINTQNPRISGPNPVVPMPTLSPMGMTQPLSHSNQMPSPNAVGPNIPPHGVPMGPGLMSHNPIM   1051 - 1120
GHGSQEPPMVPQGRMGFPQGFPPVQSPPQQVPFPHNGPSGGQGSFPGGMGFPGEGPLGRPSNLPQSSADA   1121 - 1190
ALCKPGGPGGPDSFTVLGNSMPSVFTDPDLQEVIRPGATGIPEFDLSRIIPSEKPSQTLQYFPRGEVPGR   1191 - 1260
KQPQGPGPGFSHMQGMMGEQAPRMGLALPGMGGPGPVGTPDIPLGTAPSMPGHNPMRPPAFLQQGMMGPH   1261 - 1330
HRMMSPAQSTMPGQPTLMSNPAAAVGMIPGKDRGPAGLYTHPGPVGSPGMMMSMQGMMGPQQNIMIPPQM   1331 - 1400
RPRGMAADVGMGGFSQGPGNPGNMMF                                               1401 - 1426
//

Text Mined References (43)

PMID Year Title
26844272 2015 BCL9/9L-?-catenin Signaling is Associated With Poor Outcome in Colorectal Cancer.
26384318 2015 Expression profiling of in vivo ductal carcinoma in situ progression models identified B cell lymphoma-9 as a molecular driver of breast cancer invasion.
26081897 2015 PCDH10 inhibits cell proliferation of multiple myeloma via the negative regulation of the Wnt/?-catenin/BCL-9 signaling pathway.
24599134 2014 miR-30-5p functions as a tumor suppressor and novel therapeutic tool by targeting the oncogenic Wnt/?-catenin/BCL9 pathway.
24419084 2014 LEF1 and B9L shield ?-catenin from inactivation by Axin, desensitizing colorectal cancer cells to tankyrase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23386608 2013 Dynamics of the rhomboid-like protein RHBDD2 expression in mouse retina and involvement of its human ortholog in retinitis pigmentosa.
23382809 2013 BCL9 and C9orf5 are associated with negative symptoms in schizophrenia: meta-analysis of two genome-wide association studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22914623 2012 Targeted disruption of the BCL9/?-catenin complex inhibits oncogenic Wnt signaling.
22024689 2011 MicroRNA-30c-2* expressed in ovarian cancer cells suppresses growth factor-induced cellular proliferation and downregulates the oncogene BCL9.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399610 2011 Jerky/Earthbound facilitates cell-specific Wnt/Wingless signalling by modulating ?-catenin-TCF activity.
21383261 2011 Common variants in the BCL9 gene conferring risk of schizophrenia.
20637214 2010 Allosteric remodelling of the histone H3 binding pocket in the Pygo2 PHD finger triggered by its binding to the B9L/BCL9 co-factor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19738061 2009 BCL9 promotes tumor progression by conferring enhanced proliferative, metastatic, and angiogenic properties to cancer cells.
19715304 2009 Analysis of the interaction of BCL9 with beta-catenin and development of fluorescence polarization and surface plasmon resonance binding assays for this interaction.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19328798 2009 A colorectal cancer expression profile that includes transforming growth factor beta inhibitor BAMBI predicts metastatic potential.
18789482 2009 Overexpression and altered subcellular localization of autophagy-related 16-like 1 in human oral squamous-cell carcinoma: correlation with lymphovascular invasion and lymph-node metastasis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18498752 2008 Decoding of methylated histone H3 tail by the Pygo-BCL9 Wnt signaling complex.
18347063 2008 Cell-type-specific function of BCL9 involves a transcriptional activation domain that synergizes with beta-catenin.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17113272 2007 BCL9-2 binds Arm/beta-catenin in a Tyr142-independent manner and requires Pygopus for its function in Wg/Wnt signaling.
17052462 2006 Crystal structure of a beta-catenin/BCL9/Tcf4 complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16630820 2006 Parafibromin/Hyrax activates Wnt/Wg target gene transcription by direct association with beta-catenin/Armadillo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14612447 2004 Pygopus residues required for its binding to Legless are critical for transcription and development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12047235 2002 Linkage and cytogenetic mapping of the BCL9 gene to porcine chromosome 4.
11955446 2002 Wnt/wingless signaling requires BCL9/legless-mediated recruitment of pygopus to the nuclear beta-catenin-TCF complex.
10602418 1999 Fluorescence in situ hybridization analysis of chromosome 1 abnormalities in hematopoietic disorders: rearrangements of DNA satellite II and new recurrent translocations.
9490669 1998 Molecular cloning of translocation t(1;14)(q21;q32) defines a novel gene (BCL9) at chromosome 1q21.