Property Summary

NCBI Gene PubMed Count 95
PubMed Score 282.31
PubTator Score 234.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -1.100 1.7e-02
medulloblastoma, large-cell -1.200 9.2e-05
Atopic dermatitis 1.100 3.1e-04
tuberculosis -1.200 6.1e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
lung cancer -3.100 2.8e-05
interstitial cystitis 1.100 1.4e-03
posterior fossa group A ependymoma 1.100 1.2e-03
subependymal giant cell astrocytoma 1.258 3.9e-02
psoriasis 1.300 1.5e-36
non-inflammatory breast cancer 1.200 6.3e-04
lung carcinoma -1.100 1.9e-06
ovarian cancer 1.500 3.5e-04
head and neck cancer 1.200 3.9e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2049 screening 8 / 0 / 7 Late stage results from the probe development effort to identify activators of signal transducer and activator of transcription 3 (STAT3).

Gene RIF (65)

PMID Text
26526716 Bcl3 reduces the inflammatory response in pancreas/biliary tissue by blocking ubiquitination and proteasome-mediated degradation of nuclear factor-kappaB p50 homodimers.
26138292 Bcl-3 is involved in the development of Tfh cells and the pathogenesis of RA, presumably by inducing IL-21 production.
26122346 Variant of BCL3 gene is strongly associated with five-year survival of non-small-cell lung cancer patients
25929479 Subcellular localization of Bcl-3 could be a potential-early diagnostic marker in colon cancer.
25922067 data show that BCL-3 makes extensive contacts with p50 homodimers and in particular with ankyrin repeats (ANK) 1, 6, and 7, and the N-terminal region of Bcl-3.
25873381 These findings suggest that the two LMP1 signaling domains modulate their combined activity and that the bcl3 transcription factor is likely responsible for some of the unique effects of CTAR1 domain on cellular expression.
25374339 Suggest the involvement of BCL3 in cardiovascular disease, which could be partly mediated through the influence on metabolic phenotypes.
24867235 DC-SIGN directs adaptive T helper cell type-2immunity to fucose-expressing pathogens via an IKKepsilon-CYLD-dependent signalling pathway leading to Bcl3 activation.
24162774 HIV-1 gp120 upregulates the expression of B-cell CLL/lymphoma 3 (BCL3) in human B cells
24130828 a delayed (incoherent) feed-forward loop together with differential rates of TNFA (fast) and BCL3 (slow) mRNA turnover provide robust, pulsatile expression of TNFalpha
23898208 HIV-1 gp120 upregulates the expression of B-cell CLL/lymphoma 3 (BCL3) in human B cells
23794716 Bcl-3 plays a critical role in stabilizing c-Myc protein via ERK activation.
23669365 RHBDD1 could inhibit cell apoptosis by activating and upregulating c-Jun and its downstream target, Bcl-3
23607276 elevated expression in patients with Crohn's disease and ulcerative colitis
23534762 Bcl-3 may contribute to the adult T cell leukemia development through the positive regulation of cell growth, DNA stabilization and NF-kappaB activation.
23494744 It protects cells from apoptosis by regulationg apoptotic pathways.
23149915 These results indicate for the first time a cell-autonomous disease-modifying role for Bcl3 in vivo, affecting metastatic disease progression rather than primary tumor growth.
23115114 Carriers of BCL3 allele rs7257231T had longer posterior cranial bases than noncarriers, and in the familial-based association test showed the statistically strongest relationship to phenotype.
22782967 acute alcohol treatment induces molecular signatures of TLR4/LPS tolerance through the induction of Bcl-3
22580608 using Bcl-3 knockdown in prostate cancer cells, identified the inhibitor of DNA-binding (Id) family of helix-loop-helix proteins as potential Bcl-3-regulated genes
21912613 a novel mechanism for regulatory control of CTCF in UV stress-induced human corneal epithelial cells, which requires activation and formation of Bcl-3/p50 complex through a noncanonical NF-kappaB pathway
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20974051 We validated STAT3 as a bona fide target of BCL3 in a cervical cancer cell line by additional interference RNA and in silico analyses of previously reported lymphoma patients.
20800578 this study reveals a novel combinatorial role for Bcl3 and CtBP1, providing an explanation for the acquisition of resistance to apoptosis in cancer cells, which is a major requirement for cancer development.
20737317 COX-2 inhibitor can inhibit the expression of BCL-3 and cyclin D1 in a dose-dependent manner human colon cancer cell line SW480.
20731879 found that depleting Bcl-3 protein using shRNAs induce a decrease of proliferation and clonogenic survival associated with the induction of multinucleation and increased ploidy
20672350 Observational study of gene-disease association. (HuGE Navigator)
20658525 inhibitory effect on OC cell growth was mediated by miR-125b inhibition of the translation of an mRNA encoding a proto-oncogene, BCL3
20634891 Observational study of gene-disease association. (HuGE Navigator)
20601676 Genetic variations of UBE2L3 and BCL3 are potential new risk genes for Crohn's disease.
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20572854 Observational study of gene-disease association. (HuGE Navigator)
20558726 Data defined a unique motif of BCL-3 that is needed for its recruitment to the proteasome and identified PSMB1 as a key protein required for the proteasome-mediated degradation of a nuclear and oncogenic IkappaB protein.
20547759 Biochemical purification of interacting partners of BCL-3 led to the identification of CtBP as a molecule required for the ability of BCL-3 to repress gene transcription.
20471052 Human T cell leukemia virus type 1 (HTLV-1) oncoprotein Tax increases Bcl3 expression, which is associated with enhanced growth of HTLV-1-infected T cells.
20414006 NF-kB and Bcl-3 activation are prognostic in metastatic colorectal cancer
20226764 Bcl-3 interacts with the pleckstrin homology domain and the phosphotyrosine binding domain of IRS-3, and that IRS-3 interacts with the ankyrin repeat domain of Bcl-3.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19806201 JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network hasa role in basal cancer cell survival
19617629 adiponectin augmented the expression of A20, suppressor of cytokine signaling (SOCS) 3, B-cell CLL/lymphoma (BCL) 3, TNF receptor-associated factor (TRAF) 1, and TNFAIP3-interacting protein (TNIP) 3.
19494302 activation of p52/Bcl-3 complexes in monocyte-derived macrophages (MDM) and p50/p65 heterodimers in fibroblasts in response to HCMV infection might explain the low-level growth of the virus in MDMs vs efficient growth in fibroblasts
19451226 Transcriptional profiling demonstrated that Bcl3 activates genes involved in diverse pathways including a subset involved in cellular energy metabolism known to be regulated by PGC-1alpha, ERRalpha, and a second nuclear receptor, PPARalpha.
19383626 elevated lung levels of IL-10 may impair MTb-mediated alveolar macrophage apoptosis in HIV through a BCL-3-dependent mechanism
19282837 Bcl-3 as an important modulator of cutaneous innate immune responses and its possible therapeutic role in atopic dermatitis (AD).
19229118 Observational study of gene-disease association. (HuGE Navigator)
19191868 BCL3 is a common target gene for several growth-promoting cytokines in myeloma cells and high expression of BCL3 at the time of diagnosis is associated with poor prognosis of patients with multiple myeloma
18940474 BCL2 or BCL3 are recurrent translocation partners of the IGH locus in cHL (classical Hodgkin lymphomas).
18796561 Buthionine sulfoximine activates a noncanonical, inhibitory NF-kappaB- and p65-independent NF-kappaB pathway via a multistep process leading to the up-regulation of Bcl-2
18025803 demonstrated that HCCs almost universally overexpress Bcl-3 and preferentially express nuclear p52 and p50, with little evidence of p65 activation.
17963943 Bcl-3 is rapidly induced following the expression of Epstein-Barr virus LMP1.
17881446 induction of p50/p50/Bcl-3 complexes by latent membrane protein 1 (LMP1) C-terminal activating region 1 mediates LMP1-induced epidermal growth factor receptor upregulation
17644518 BCL3 functions as a repressor of HTLV-1 LTR-mediated transcription through interactions with TORC3
17495977 study indicates that BCL3 translocations are not restricted to B-cell chronic lymphocytic leukemia but present in a heterogeneous group of B-cell malignancies
17272867 Observational study of gene-disease association. (HuGE Navigator)
16940298 HBx and NF-kappaB2/BCL3 mediated-cyclin D1 up-regulation might play an important role in the HBx-mediated HCC development and progression
16732314 overexpression of BCL3 increases apoptosis, whereas BCL3-specific siRNA does not affect the viability of INA-6 cells suggesting that BCL3 is not essential for the survival of these cells
16311697 Observational study of gene-disease association. (HuGE Navigator)
16123212 elevated Bcl-3 expression has an important function in classical Hodgkin lymphoma and peripheral T-cell non-Hodgkin lymphoma, in particular anaplastic large-cell lymphomas
16108830 (p52)2/Bcl-3P ternary complex, which is specifically induced in CD30-stimulated anaplasstic larage cell lymphoma, can modulate expression of apoptosis-related genes regulated by NF-kappaB.
16099425 Bcl-3 might participate in oncogenic pathways involving Lck
15634875 Supported by IL-12 signals, Bcl-3 enhances survival and clonal expansion of transgenic OT-1 CD8 T cells.
15105810 The relatively high frequency of BCL-3 expression in some non-Hodgkin and Hodgkin lymphoma types raises the possibility that BCL-3 is involved in the pathogenesis of these tumors, and may be a target of new therapies.
12808109 BCL3 is downregulated by p53 to repress cyclin D1 and has a role in regulation of cell cycle progression
12456498 High-level expression of BCL3 differentiates t(2;5)(p23;q35)-positive anaplastic large cell lymphoma from Hodgkin disease.
1923524 Characterization of the mouse BCL3 ortholog and comparison to the human gene.

AA Sequence

MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPLRGGCDLPAVP      1 - 70
GPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLH     71 - 140
IAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAH    141 - 210
LACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPL    211 - 280
IHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVAR    281 - 350
SRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN    351 - 420
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS                                        421 - 454
//

Text Mined References (97)

PMID Year Title
26526716 2016 BCL3 Reduces the Sterile Inflammatory Response in Pancreatic and Biliary Tissues.
26138292 2015 Role of Bcl-3 in the development of follicular helper T cells and in the pathogenesis of rheumatoid arthritis.
26122346 2015 Variant of BCL3 gene is strongly associated with five-year survival of non-small-cell lung cancer patients.
25929479 2015 Early diagnostic value of Bcl-3 localization in colorectal cancer.
25922067 2015 Mapping the Interaction of B Cell Leukemia 3 (BCL-3) and Nuclear Factor ?B (NF-?B) p50 Identifies a BCL-3-mimetic Anti-inflammatory Peptide.
25873381 2015 Changes in expression induced by Epstein-Barr Virus LMP1-CTAR1: potential role of bcl3.
25374339 2015 An integrated genomic-transcriptomic approach supports a role for the proto-oncogene BCL3 in atherosclerosis.
24867235 2014 Fucose-specific DC-SIGN signalling directs T helper cell type-2 responses via IKK?- and CYLD-dependent Bcl3 activation.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24130828 2013 BCL-3 attenuation of TNFA expression involves an incoherent feed-forward loop regulated by chromatin structure.
23794716 2013 The I?B family member Bcl-3 stabilizes c-Myc in colorectal cancer.
23669365 2013 Rhomboid domain containing 1 inhibits cell apoptosis by upregulating AP-1 activity and its downstream target Bcl-3.
23607276 2013 Bcl-3 deficiency protects against dextran-sodium sulphate-induced colitis in the mouse.
23565137 2013 SORL1 is genetically associated with late-onset Alzheimer's disease in Japanese, Koreans and Caucasians.
23534762 2013 Knockdown of Bcl-3 inhibits cell growth and induces DNA damage in HTLV-1-infected cells.
23494744 2013 Bcl-3 regulates UVB-induced apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149915 2013 Bcl3 selectively promotes metastasis of ERBB2-driven mammary tumors.
23115114 2012 BCL3 gene role in facial morphology.
22782967 2012 Induction of Bcl-3 by acute binge alcohol results in toll-like receptor 4/LPS tolerance.
22580608 2013 Expression of Id proteins is regulated by the Bcl-3 proto-oncogene in prostate cancer.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21912613 2011 Activation of oxidative stress-regulated Bcl-3 suppresses CTCF in corneal epithelial cells.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20974051 2010 Gene regulation by BCL3 in a cervical cancer cell line.
20800578 2010 Bcl3-dependent stabilization of CtBP1 is crucial for the inhibition of apoptosis and tumor progression in breast cancer.
20737317 2010 [Effect of COX-2 inhibitor on the expression of BCL-3 and cyclin D1 in human colon cancer cell line SW480].
20731879 2010 Depletion of the oncoprotein Bcl-3 induces centrosome amplification and aneuploidy in cancer cells.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20658525 2011 MiR-125b targets BCL3 and suppresses ovarian cancer proliferation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20558726 2010 BCL-3 degradation involves its polyubiquitination through a FBW7-independent pathway and its binding to the proteasome subunit PSMB1.
20547759 2010 The repressing function of the oncoprotein BCL-3 requires CtBP, while its polyubiquitination and degradation involve the E3 ligase TBLR1.
20471052 2010 Activation of the PI3K-Akt pathway by human T cell leukemia virus type 1 (HTLV-1) oncoprotein Tax increases Bcl3 expression, which is associated with enhanced growth of HTLV-1-infected T cells.
20414006 2010 NF-kB and Bcl-3 activation are prognostic in metastatic colorectal cancer.
20226764 2010 Insulin receptor substrate-3, interacting with Bcl-3, enhances p50 NF-kappaB activity.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19806201 2009 Basal cancer cell survival involves JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network.
19617629 2009 Adiponectin inhibits pro-inflammatory signaling in human macrophages independent of interleukin-10.
19494302 2009 Bcl-3-regulated transcription from major immediate-early promoter of human cytomegalovirus in monocyte-derived macrophages.
19451226 2009 Bcl3 interacts cooperatively with peroxisome proliferator-activated receptor gamma (PPARgamma) coactivator 1alpha to coactivate nuclear receptors estrogen-related receptor alpha and PPARalpha.
19383626 2009 Impaired M. tuberculosis-mediated apoptosis in alveolar macrophages from HIV+ persons: potential role of IL-10 and BCL-3.
19282837 2009 Bcl-3 acts as an innate immune modulator by controlling antimicrobial responses in keratinocytes.
19229118 2009 Differential parental transmission of markers in BCL3 among Korean cleft case-parent trios.
19191868 2009 High expression of BCL3 in human myeloma cells is associated with increased proliferation and inferior prognosis.
18940474 2008 BCL2 and BCL3 are recurrent translocation partners of the IGH locus.
18796561 2009 Oxidative, multistep activation of the noncanonical NF-kappaB pathway via disulfide Bcl-3/p50 complex.
18025803 2007 Expression of nuclear factor-kappaB family proteins in hepatocellular carcinomas.
17963943 2008 The latent membrane protein 1 (LMP1) encoded by Epstein-Barr virus induces expression of the putative oncogene Bcl-3 through activation of the nuclear factor-kappaB.
17881446 2007 Induction of epidermal growth factor receptor expression by Epstein-Barr virus latent membrane protein 1 C-terminal-activating region 1 is mediated by NF-kappaB p50 homodimer/Bcl-3 complexes.
17644518 2007 BCL3 acts as a negative regulator of transcription from the human T-cell leukemia virus type 1 long terminal repeat through interactions with TORC3.
17495977 2007 A comprehensive genetic and histopathologic analysis identifies two subgroups of B-cell malignancies carrying a t(14;19)(q32;q13) or variant BCL3-translocation.
17272867 2007 Few associations of candidate genes with nonsyndromic orofacial clefts in the population of Lithuania.
16940298 2006 Up-regulation of cyclin D1 by HBx is mediated by NF-kappaB2/BCL3 complex through kappaB site of cyclin D1 promoter.
16732314 2006 BCL3 is induced by IL-6 via Stat3 binding to intronic enhancer HS4 and represses its own transcription.
16384933 2006 Expression of the Bcl-3 proto-oncogene suppresses p53 activation.
16311697 2005 [Possible association due to linkage disequilibrium of TGFA, RARA and BCL3 with nonsyndromic cleft lip with or without cleft palate in the Chilean population].
16306601 2005 Respiratory syncytial virus-inducible BCL-3 expression antagonizes the STAT/IRF and NF-kappaB signaling pathways by inducing histone deacetylase 1 recruitment to the interleukin-8 promoter.
16280327 2006 A pathway for tumor necrosis factor-alpha-induced Bcl10 nuclear translocation. Bcl10 is up-regulated by NF-kappaB and phosphorylated by Akt1 and then complexes with Bcl3 to enter the nucleus.
16123212 2005 Elevated NF-kappaB p50 complex formation and Bcl-3 expression in classical Hodgkin, anaplastic large-cell, and other peripheral T-cell lymphomas.
16108830 2005 Stimulation of CD30 in anaplastic large cell lymphoma leads to production of nuclear factor-kappaB p52, which is associated with hyperphosphorylated Bcl-3.
16099425 2005 Regulation of Bcl-3 through interaction with the Lck tyrosine kinase.
15829968 2005 Transcriptional regulation of a metastasis suppressor gene by Tip60 and beta-catenin complexes.
15634875 2005 Cutting edge: Bcl-3 up-regulation by signal 3 cytokine (IL-12) prolongs survival of antigen-activated CD8 T cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469820 2004 GSK3-mediated BCL-3 phosphorylation modulates its degradation and its oncogenicity.
15105810 2004 Immunohistochemical detection of BCL-3 in lymphoid neoplasms: a survey of 353 cases.
12808109 2003 p53 represses cyclin D1 transcription through down regulation of Bcl-3 and inducing increased association of the p52 NF-kappaB subunit with histone deacetylase 1.
12730195 2003 Identification and characterization of BCL-3-binding protein: implications for transcription and DNA repair or recombination.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456498 2003 High-level expression of BCL3 differentiates t(2;5)(p23;q35)-positive anaplastic large cell lymphoma from Hodgkin disease.
11707390 2001 Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
11485202 2001 A tomato homologue of the human protein PIRIN is induced during programmed cell death.
11387332 2001 NF-kappa B-inducible BCL-3 expression is an autoregulatory loop controlling nuclear p50/NF-kappa B1 residence.
10607713 2000 Differential expression of Rel/NF-kappaB and octamer factors is a hallmark of the generation and maturation of dendritic cells.
10497212 1999 Bcl3, an IkappaB protein, stimulates activating protein-1 transactivation and cellular proliferation.
10469655 1999 NF-kappaB p105 is a target of IkappaB kinases and controls signal induction of Bcl-3-p50 complexes.
10362352 1999 The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators.
9812988 1998 Bcl3, an IkappaB protein, as a novel transcription coactivator of the retinoid X receptor.
9576921 1998 Signal-dependent translation of a regulatory protein, Bcl-3, in activated human platelets.
9407099 1997 Diverse effects of BCL3 phosphorylation on its modulation of NF-kappaB p52 homodimer binding to DNA.
9218802 1997 Regulation of NFKB1 proteins by the candidate oncoprotein BCL-3: generation of NF-kappaB homodimers from the cytoplasmic pool of p50-p105 and nuclear translocation.
8497270 1993 The bcl-3 proto-oncogene encodes a nuclear I kappa B-like molecule that preferentially interacts with NF-kappa B p50 and p52 in a phosphorylation-dependent manner.
8453667 1993 The oncoprotein Bcl-3 directly transactivates through kappa B motifs via association with DNA-binding p50B homodimers.
8428580 1993 The NF-kappa B precursor p105 and the proto-oncogene product Bcl-3 are I kappa B molecules and control nuclear translocation of NF-kappa B.
8330739 1993 The candidate proto-oncogene bcl-3 encodes a transcriptional coactivator that activates through NF-kappa B p50 homodimers.
8196632 1994 BCL3 encodes a nuclear protein which can alter the subcellular location of NF-kappa B proteins.
7896265 1994 Genomic structure of the candidate proto-oncogene BCL3.
7691160 1993 Cloning and sequencing of a t(14;19) breakpoint that involves the C mu switch region.
2180580 1990 The candidate proto-oncogene bcl-3 is related to genes implicated in cell lineage determination and cell cycle control.
2124350 1990 Sequences of human immunoglobulin switch regions: implications for recombination and transcription.
1923524 1991 Mouse bcl-3: cDNA structure, mapping and stage-dependent expression in B lymphocytes.
1501714 1992 Candidate proto-oncogene bcl-3 encodes a subunit-specific inhibitor of transcription factor NF-kappa B.
1406939 1992 The candidate oncoprotein Bcl-3 is an antagonist of p50/NF-kappa B-mediated inhibition.