Property Summary

NCBI Gene PubMed Count 55
PubMed Score 39.54
PubTator Score 44.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2346 3.193 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.400 5.0e-10
non-small cell lung cancer 1.100 1.8e-19
invasive ductal carcinoma 1.200 3.2e-03

Gene RIF (33)

PMID Text
26797417 Identify 50 novel BCL2L12 splice variants in human tumor cell lines.
26297542 miR-125a-5p inhibits cell proliferation and induces apoptosis in colon cancer cells via targeting BCL2, BCL2L12 and Mcl-1.
26260387 CD82 regulated BCL2L12 expression via STAT5A and AKT signaling and stimulated proliferation and engrafting of leukemia cells.
26082034 Results show that high Bcl2L12 mRNA expression was associated with the high-grade breast cancer and triple-negative (TNBC) subtype. Also, the interplay between Bcl2L12 and its variant may be associated with high lymph node metastasis in non-TNBC tumors.
25586056 Bcl2L12 retains a BH3-like domain, which is important for its anti-apoptotic property.
25230343 Data indicate that BCL2-like 12 (proline rich) protein BCL2L12 mRNA levels can distinguish women with breast cancer from healthy controls.
24339738 Bcl2L12 was previously shown to inhibit apoptosis through binding to caspase 7.
24078567 Acute myeloid leukemia patients have a lower level of BCL2L12 gene expression.
23901115 Protein made from F17F mutant BCL2L12 transcript bound p53, inhibited UV-induced apoptosis more efficiently than WT BCL2L12, and reduced endogenous p53 target gene transcription.
23790536 Data indicate that BCL2L12 expression levels were associated with poor disease-free survival of the high-grade TaT1 bladder cancer patients.
23708917 cisplatin treatment induced a time-dependent apoptosis in glioblastoma cells, at least partially via downregulation of BCL2L12 gene expression.
23292833 Bcl2L12 expression efficiently discriminates chronic lymphocytic leukemia cases from healthy controls but did not reflect their clinical characteristics
22747515 results suggest BCL2L12 mRNA expression may serve as potential prognostic biomarker in tongue and/or larynx SCC, which principally constitute great majority of HNSCC cases worldwide.
22728012 BCL2L12 can be considered as a new independent prognostic and chemotherapy response marker in acute myeloid leukemia.
22664385 Molecular cloning of novel alternatively spliced variants of BCL2L12, a new member of the BCL2 gene family, and their expression analysis in cancer cells.
22431925 studies began to define the molecular mechanisms underlying therapy resistance of GBM tumors, and pointed to the Bcl-2 protein family, in particular the atypical member Bcl2-Like 12 (Bcl2L12), as important regulators of therapy-induced cell death
22262180 The BCL2L12(153-191) fragment directly interrupted GSK3beta mediated Tau phosphorylation.
21737576 BCL2L12 mRNA expression is significantly higher in CLL patients than in healthy blood donors.
21152697 Data indicate BCL2L12 expression to be an unfavorable and independent prognostic indicator of short-term relapse in nasopharyngeal carcinoma.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903463 these results open new horizons for the possible application of BCL2L12 as a novel prognostic indicator of gastric cancer.
19763795 both BCL2L12 and BCL2L12A have negative effects on cell growths, and that BCL2L12A is a potential cell cycle regulator that interferes with G2-M transition
19723066 Results indicate and support the hypothesis that the apoptosis-related genes BCL2 and BCL2L12 respond similarly to treatment
19376117 HSP70 was identified to interact with BCL2L12 and BCL2L12A and protected them from ubiquitinations and degradations in mammalian cells
18976975 Knockdown of BCL2-like 12 (BCL2L12) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18930135 Data suggest that BCL2L12 and BCL2L12A may play an important role in cisplatin-induced apoptosis in MDA-MB-231 breast cancer cells.
18928586 Bortezomib inhibited the proliferation of SHI-1 cells. Bcl2l12 mRNA expression was up-regulated, bcl-2 mRNA expression was down-regulated and bax mRNA expression was not changed.
18844453 Our results suggest that BCL2L12 gene expression may represent a potential new biomarker for colon cancer
18669646 alphaB-crystallin is a Bcl2L12-induced oncoprotein that enables Bcl2L12 to block the activation of both effector caspases via distinct mechanisms, thereby contributing to Glioblastoma multiforme pathogenesis and its hallmark biological properties.
15493871 The BCL2L12-A transcript appears to be of importance for colon cancer since its expression is associated with disease progression.
12783122 RT-PCR in 70 breast cancer tissues demonstrated that BCL2L12 positive breast tumors are mainly of lower stage (I/II) or grade (I/II) and BCL2L12 expression is positively related to disease-free and overall survival

AA Sequence

MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQV      1 - 70
EWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPC     71 - 140
SLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAIL    141 - 210
RRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARL    211 - 280
ALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD                    281 - 334
//

Text Mined References (63)

PMID Year Title
26797417 2016 Identification of novel alternative splice variants of the BCL2L12 gene in human cancer cells using next-generation sequencing methodology.
26297542 2015 miR-125a-5p inhibits cell proliferation and induces apoptosis in colon cancer via targeting BCL2, BCL2L12 and MCL1.
26260387 2015 The novel function of CD82 and its impact on BCL2L12 via AKT/STAT5 signal pathway in acute myelogenous leukemia cells.
26082034 2015 Differential roles of Bcl2L12 and its short variant in breast cancer lymph node metastasis.
25586056 2015 Bcl2L12 with a BH3-like domain in regulating apoptosis and TMZ-induced autophagy: a prospective combination of ABT-737 and TMZ for treating glioma.
25230343 2014 BCL2L12: a promising molecular prognostic biomarker in breast cancer.
24339738 2013 Estrogen receptor ? isoform 5 confers sensitivity of breast cancer cell lines to chemotherapeutic agent-induced apoptosis through interaction with Bcl2L12.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24078567 2013 [Expression of BCL2L12 gene in de novo acute myeloid leukemia and its clinical implications].
23901115 2013 Whole-genome sequencing identifies a recurrent functional synonymous mutation in melanoma.
23790536 2014 Increased BCL2L12 expression predicts the short-term relapse of patients with TaT1 bladder cancer following transurethral resection of bladder tumors.
23708917 2013 Cisplatin downregulates BCL2L12, a novel apoptosis-related gene, in glioblastoma cells.
23292833 2013 Expression of Bcl2L12 in chronic lymphocytic leukemia patients: association with clinical and molecular prognostic markers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22747515 2013 Quantitative expression analysis of the apoptosis-related gene, BCL2L12, in head and neck squamous cell carcinoma.
22728012 2012 Overexpression of the novel member of the BCL2 gene family, BCL2L12, is associated with the disease outcome in patients with acute myeloid leukemia.
22664385 2012 Molecular cloning of novel alternatively spliced variants of BCL2L12, a new member of the BCL2 gene family, and their expression analysis in cancer cells.
22431925 2012 The role of Bcl-2 family proteins in therapy responses of malignant astrocytic gliomas: Bcl2L12 and beyond.
22262180 2012 GSK3? regulates Bcl2L12 and Bcl2L12A anti-apoptosis signaling in glioblastoma and is inhibited by LiCl.
22238053 2012 Quantitative expression analysis of the apoptosis-related genes BCL2, BAX and BCL2L12 in gastric adenocarcinoma cells following treatment with the anticancer drugs cisplatin, etoposide and taxol.
21737576 2011 The novel member of the BCL2 gene family, BCL2L12, is substantially elevated in chronic lymphocytic leukemia patients, supporting its value as a significant biomarker.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21200141 2011 Beyond effector caspase inhibition: Bcl2L12 neutralizes p53 signaling in glioblastoma.
21152697 BCL2L12 is a novel biomarker for the prediction of short-term relapse in nasopharyngeal carcinoma.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20837658 2010 Glioma oncoprotein Bcl2L12 inhibits the p53 tumor suppressor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903463 2010 Molecular analysis and prognostic impact of the novel apoptotic gene BCL2L12 in gastric cancer.
19763795 2010 BCL2L12A localizes to the cell nucleus and induces growth inhibition through G2/M arrest in CHO cells.
19723066 2009 Molecular response of HL-60 cells to mitotic inhibitors vincristine and taxol visualized with apoptosis-related gene expressions, including the new member BCL2L12.
19617565 2009 Cell type-dependent proapoptotic role of Bcl2L12 revealed by a mutation concomitant with the disruption of the juxtaposed Irf3 gene.
19544381 2009 Characterization and gene expression profiling in glioma cell lines with deletion of chromosome 19 before and after microcell-mediated restoration of normal human chromosome 19.
19440006 2009 Treatment of gastric cancer cells with 5-fluorouracil/leucovorin and irinotecan induces distinct alterations in the mRNA expression of the apoptosis-related genes, including the novel gene BCL2L12.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19376117 2009 HSP70 protects BCL2L12 and BCL2L12A from N-terminal ubiquitination-mediated proteasomal degradation.
19015929 The effect of combination treatment with docosahexaenoic acid and 5-fluorouracil on the mRNA expression of apoptosis-related genes, including the novel gene BCL2L12, in gastric cancer cells.
18930135 2008 Knockdown of BCL2L12 leads to cisplatin resistance in MDA-MB-231 breast cancer cells.
18928586 2008 [Inducing-apoptosis effect of bortezomib on acute monocytic leukemia cell SHI-1 and its influence on expressions of Bcl2l12, Bcl-2 and Bax genes].
18844453 2008 Quantitative expression analysis and prognostic significance of the novel apoptosis-related gene BCL2L12 in colon cancer.
18769159 2008 What drives intense apoptosis resistance and propensity for necrosis in glioblastoma? A role for Bcl2L12 as a multifunctional cell death regulator.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18669646 2008 Bcl2L12-mediated inhibition of effector caspase-3 and caspase-7 via distinct mechanisms in glioblastoma.
17404015 2007 Breast cancer cells response to the antineoplastic agents cisplatin, carboplatin, and doxorubicin at the mRNA expression levels of distinct apoptosis-related genes, including the new member, BCL2L12.
17384250 2006 Alterations in mRNA expression of apoptosis-related genes BCL2, BAX, FAS, caspase-3, and the novel member BCL2L12 after treatment of human leukemic cell line HL60 with the antineoplastic agent etoposide.
17210792 2007 Bcl2L12 inhibits post-mitochondrial apoptosis signaling in glioblastoma.
17132110 2006 Topotecan and methotrexate alter expression of the apoptosis-related genes BCL2, FAS and BCL2L12 in leukemic HL-60 cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16895478 2006 Treatment of MCF-7 cells with taxol and etoposide induces distinct alterations in the expression of apoptosis-related genes BCL2, BCL2L12, BAX, CASPASE-9 and FAS.
16647810 2007 Prognostic value of the apoptosis related genes BCL2 and BCL2L12 in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15576332 2004 mRNA expression analysis of a variety of apoptosis-related genes, including the novel gene of the BCL2-family, BCL2L12, in HL-60 leukemia cells after treatment with carboplatin and doxorubicin.
15493871 2004 Expression analysis of BCL2L12, a new member of apoptosis-related genes, in colon cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14759258 2004 An unappreciated role for RNA surveillance.
12783122 2003 Expression of BCL2L12, a new member of apoptosis-related genes, in breast tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401436 2001 Molecular cloning, physical mapping, and expression analysis of a novel gene, BCL2L12, encoding a proline-rich protein with a highly conserved BH2 domain of the Bcl-2 family.
11283018 2001 In vitro selection and characterization of Bcl-X(L)-binding proteins from a mix of tissue-specific mRNA display libraries.