Property Summary

NCBI Gene PubMed Count 37
PubMed Score 22.69
PubTator Score 22.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.104 9.6e-04
juvenile dermatomyositis 1.153 9.2e-11
adrenocortical carcinoma 1.096 3.4e-03
lung cancer 1.100 5.6e-04
group 3 medulloblastoma 1.500 3.0e-03
subependymal giant cell astrocytoma 1.713 9.2e-03
ovarian cancer 2.100 3.1e-05

Gene RIF (17)

PMID Text
25150171 The BCCIPbeta, but not BCCIPalpha, interacts with EIF6 and RPL23/UL14 and stabilizes the latter.
23911796 Results indicate that BCCIP germ line mutations are unlikely to be a major contributor to familial breast/ovarian cancer risk in our population.
19861517 Observational study of gene-disease association. (HuGE Navigator)
19713748 regulation of p21 intracellular distribution is a new mechanism for BCCIP to modulate p21 functions
19653894 BCCIP protein expression was not detectable in approximately 45% of all astrocytic tumors.
19578363 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18773424 BCCIP is phosphorylated by the Src tyrosine kinase and dephosphorylated by the PTPmu tyrosine phosphatase; neurite outgrowth assays suggest that BCCIP and PTPmu are in a common signal transduction pathway.
18440304 LYRIC/AEG-1 is a negative regulator of BCCIPalpha, promoting proteasomal degradation either through direct interaction, or potentially through an indirect mechanism involving downstream effects of the NF-kappaB signaling pathway.
18413737 BCCIP-dependent repair of double strand breaks by homologous recombination is an early RAD51 response to ionizing radiation-induced DNA damage.
17452982 suggest an essential role of BCCIP in the maintenance of genomic integrity
17135243 BCCIP in maintaining the transactivation activity of wild type p53; down-regulation of BCCIP as a novel mechanism to impair the p53 function in cells harboring wild type p53
15713648 BCCIP is critical for BRCA2- and RAD51-dependent responses to DNA damage and homologous recombinational repair.
14726710 Overexpression of BCCIP beta delays the G1 to S progression and results in an elevated p21 expression
11836363 Unique de novo mutation of BRCA2 has been identified in a woman with early onset breast cancer.
11754111 BRCA2 germline mutations appear to have a milder clinical phenotype when compared to non-BRCA2 mutations, since survival is higher among breast cancer patients carrying a BRCA2 mutation compared to sporadic breast cancers.
11748848 In BRCA2, two novel frame shift mutations were identified as 5073-5074delCT and 6866delC.

AA Sequence

MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND      1 - 70
YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ     71 - 140
CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN    141 - 210
KPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW    211 - 280
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV                                        281 - 314
//

Text Mined References (43)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25150171 2014 The beta-isoform of the BRCA2 and CDKN1A(p21)-interacting protein (BCCIP) stabilizes nuclear RPL23/uL14.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911796 2013 Mutation analysis of the BCCIP gene for breast cancer susceptibility in breast/ovarian cancer families.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19861517 2009 Predisposition for TMPRSS2-ERG fusion in prostate cancer by variants in DNA repair genes.
19713748 2009 BCCIP is required for the nuclear localization of the p21 protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19653894 2009 Alterations of BCCIP, a BRCA2 interacting protein, in astrocytomas.
19578363 2009 New common variants affecting susceptibility to basal cell carcinoma.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18773424 2008 BCCIP associates with the receptor protein tyrosine phosphatase PTPmu.
18440304 2008 LYRIC/AEG-1 overexpression modulates BCCIPalpha protein levels in prostate tumor cells.
18413737 2008 Distinct RAD51 associations with RAD52 and BCCIP in response to DNA damage and replication stress.
18299662 2008 Proteomic analysis of cervical cancer cells treated with adenovirus-mediated MDA-7.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17947333 2007 BCCIP regulates homologous recombination by distinct domains and suppresses spontaneous DNA damage.
17452982 2007 Roles of BCCIP in chromosome stability and cytokinesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17135243 2007 Abrogation of the transactivation activity of p53 by BCCIP down-regulation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16341674 2005 Transcriptome analysis of human gastric cancer.
16247447 2006 Identification of novel genomic markers related to progression to glioblastoma through genomic profiling of 25 primary glioma cell lines.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15713648 2005 The BRCA2-interacting protein BCCIP functions in RAD51 and BRCA2 focus formation and homologous recombinational repair.
15539944 2004 BCCIP functions through p53 to regulate the expression of p21Waf1/Cip1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14726710 2004 Inhibition of G1 to S cell cycle progression by BCCIP beta.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527204 2003 Genomic structure of the human BCCIP gene and its expression in cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11754111 2002 BRCA2 gene mutations in Greek patients with familial breast cancer.
11748848 2001 Novel germline BRCA1 and BRCA2 mutations in breast and breast/ovarian cancer families from the Czech Republic.
11313963 2001 Inhibition of breast and brain cancer cell growth by BCCIPalpha, an evolutionarily conserved nuclear protein that interacts with BRCA2.
10878006 2000 TOK-1, a novel p21Cip1-binding protein that cooperatively enhances p21-dependent inhibitory activity toward CDK2 kinase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1571364 1992 2-Bromopalmitoyl-CoA and 2-bromopalmitate: promiscuous inhibitors of membrane-bound enzymes.