Property Summary

NCBI Gene PubMed Count 34
PubMed Score 30.54
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Williams Syndrome 10
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Williams-Beuren syndrome 45

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.400 1.4e-05
osteosarcoma -1.779 2.7e-07
astrocytoma 1.500 5.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.8e-03
group 3 medulloblastoma 1.100 2.0e-03
ovarian cancer 1.200 3.7e-04

Gene RIF (11)

PMID Text
23319141 Data indicate that the heterochromatic H2A.X is preferentially phosphorylated presumably by the accumulating WSTF-ISWI chromatin remodeling (WICH) complex, and suggests that Tyr142p might have a specific role in heterochromatin.
23085504 EB1089 inhibits aromatase expression by dissociation of comodulator WSTF from the CYP19A1 promoter.
21326359 This review describes the three known WSTF-containing complexes and discuss their various roles as well as mechanisms of regulating WSTF activity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20580033 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19656773 Observational study of gene-disease association. (HuGE Navigator)
19454010 The WICH complex, composed of WSTF and SNF2H, are identified to interact with HIV-1 Tat in Jurkat cell
19092802 WSTF phosphorylates Tyr 142 of H2A.X, and WSTF activity has an important role in regulating several events that are critical for the DNA damage response
16603771 WSTF-SNF2h-NM1 forms a platform in transcription while providing chromatin remodeling
16514417 A multiprotein complex containing WSTF, nuclear myosin 1 (NM1), and SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily A member 5 protein(SNF2h) is required for ribosomal DNA transcription.

AA Sequence

MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQ      1 - 70
EVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPL     71 - 140
EKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGER    141 - 210
KWAPPKFLPHKYDVKLQNEDKIISNVPADSLIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVK    211 - 280
KYSLPSKFSDFLLDPYKYMTLNPSTKRKNTGSPDRKPSKKSKTDNSSLSSPLNPKLWCHVHLKKSLSGSP    281 - 350
LKVKNSKNSKSPEEHLEEMMKMMSPNKLHTNFHIPKKGPPAKKPGKHSDKPLKAKGRSKGILNGQKSTGN    351 - 420
SKSPKKGLKTPKTKMKQMTLLDMAKGTQKMTRAPRNSGGTPRTSSKPHKHLPPAALHLIAYYKENKDRED    421 - 490
KRSALSCVISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSEEQRKEYLKKKREELKKKLKE    491 - 560
KAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQY    561 - 630
PITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRSD    631 - 700
VQEESEGSDTDDNKDSAAFEDNEVQDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQ    701 - 770
QMSAELWKERLAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMIS    771 - 840
AVKSRRLLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHN    841 - 910
RYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDEDYCPRSKKANLGKNASMNTQHGTATEVAVE    911 - 980
TTTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQDIIHSIHLARKPNLGLKSCDGNQE    981 - 1050
LLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRR   1051 - 1120
KLQSEDSAKTEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVC   1121 - 1190
RKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNSRGRNYTEESASEDSEDDESD   1191 - 1260
EEEEEEEEEEEEEDYEVAGLRLRPRKTIRGKHSVIPPAARSGRRPGKKPHSTRRSQPKAPPVDDAEVDEL   1261 - 1330
VLQTKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRS   1331 - 1400
VQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEP   1401 - 1470
EAVGQSRGRRQKK                                                            1471 - 1483
//

Text Mined References (49)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23319141 2013 The proteomic investigation of chromatin functional domains reveals novel synergisms among distinct heterochromatin components.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085504 2013 Vitamin D analog EB1089 inhibits aromatase expression by dissociation of comodulator WSTF from the CYP19A1 promoter-a new regulatory pathway for aromatase.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21326359 2011 WSTF does it all: a multifunctional protein in transcription, repair, and replication.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20802025 2010 Genome-wide association study identifies novel loci for plasma levels of protein C: the ARIC study.
20657596 2010 Excess of rare variants in genes identified by genome-wide association study of hypertriglyceridemia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20580033 2010 Replication of recently described type 2 diabetes gene variants in a South Indian population.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19234442 2009 Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.
19092802 2009 WSTF regulates the H2A.X DNA damage response via a novel tyrosine kinase activity.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18162579 2008 Identification of novel human Cdt1-binding proteins by a proteomics approach: proteolytic regulation by APC/CCdh1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16603771 2006 The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16514417 2006 The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16252006 2005 Ligand-induced transrepression by VDR through association of WSTF with acetylated histones.
15635413 2005 Nucleolar proteome dynamics.
15543136 2004 The Williams syndrome transcription factor interacts with PCNA to target chromatin remodelling by ISWI to replication foci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980720 2002 WSTF-ISWI chromatin remodeling complex targets heterochromatic replication foci.
11124022 2000 Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.
10662543 2000 A novel family of bromodomain genes.
9858827 1998 Identification of the WBSCR9 gene, encoding a novel transcriptional regulator, in the Williams-Beuren syndrome deletion at 7q11.23.
9847074 1998 Toward a complete human genome sequence.
9828126 1998 A novel human gene, WSTF, is deleted in Williams syndrome.