Property Summary

NCBI Gene PubMed Count 20
PubMed Score 29.70
PubTator Score 21.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid arthritis 1.300 5.2e-03
acute quadriplegic myopathy 1.112 4.9e-07
adult high grade glioma 1.500 1.0e-03
astrocytoma 1.300 3.2e-17
Astrocytoma, Pilocytic 1.100 3.0e-04
atypical teratoid / rhabdoid tumor 1.800 7.1e-05
Breast cancer 3.400 2.8e-02
diabetes mellitus -1.400 7.3e-03
ductal carcinoma in situ 1.300 1.3e-04
ependymoma 1.400 2.2e-07
glioblastoma 1.900 3.5e-07
group 3 medulloblastoma 2.200 3.0e-04
intraductal papillary-mucinous adenoma (... 1.200 1.4e-02
intraductal papillary-mucinous carcinoma... 1.100 4.9e-02
juvenile dermatomyositis 1.135 1.5e-11
lung carcinoma -2.300 9.4e-27
medulloblastoma, large-cell 3.200 4.3e-06
oligodendroglioma 1.400 1.6e-12
osteosarcoma -1.341 4.1e-03
ovarian cancer 1.500 2.3e-05
Pick disease 1.500 1.6e-04
pituitary cancer -1.900 1.0e-07
primitive neuroectodermal tumor 2.700 1.8e-06
subependymal giant cell astrocytoma 1.536 2.7e-02
tuberculosis and treatment for 3 months -1.100 1.0e-03

Gene RIF (10)

AA Sequence

MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALES      1 - 70
EKKARQNLQSFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEETVEVIRNNGARLQCRILEVL     71 - 140
PPSHQNGFANGHVNSVDGETIIISDSDDSETQSCSFQNGKKKDAIDPLLFKYKVQPTKKELHESAIVKAT    141 - 210
QISRRKHLFSRDKLKLFLKQHCEPQDGVIKIKASSLSTYKIAEQDFSYFFPDDPPTFIFSPANRRRGRPP    211 - 280
KRIHISQEDNVANKQTLASYRSKATKERDKLLKQEEMKSLAFEKAKLKREKADALEAKKKEKEDKEKKRE    281 - 350
ELKKIVEEERLKKKEEKERLKVEREKEREKLREEKRKYVEYLKQWSKPREDMECDDLKELPEPTPVKTRL    351 - 420
PPEIFGDALMVLEFLNAFGELFDLQDEFPDGVTLEVLEEALVGNDSEGPLCELLFFFLTAIFQAIAEEEE    421 - 490
EVAKEQLTDADTKDLTEALDEDADPTKSALSAVASLAAAWPQLHQGCSLKSLDLDSCTLSEILRLHILAS    491 - 560
GADVTSANAKYRYQKRGGFDATDDACMELRLSNPSLVKKLSSTSVYDLTPGEKMKILHALCGKLLTLVST    561 - 630
RDFIEDYVDILRQAKQEFRELKAEQHRKEREEAAARIRKRKEEKLKEQEQKMKEKQEKLKEDEQRNSTAD    631 - 700
ISIGEEEREDFDTSIESKDTEQKELDQDMVTEDEDDPGSHKRGRRGKRGQNGFKEFTRQEQINCVTREPL    701 - 770
TADEEEALKQEHQRKEKELLEKIQSAIACTNIFPLGRDRMYRRYWIFPSIPGLFIEEDYSGLTEDMLLPR    771 - 840
PSSFQNNVQSQDPQVSTKTGEPLMSESTSNIDQGPRDHSVQLPKPVHKPNRWCFYSSCEQLDQLIEALNS    841 - 910
RGHRESALKETLLQEKSRICAQLARFSEEKFHFSDKPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLR    911 - 980
DFLLDIEDRIYQGTLGAIKVTDRHIWRSALESGRYELLSEENKENGIIKTVNEDVEEMEIDEQTKVIVKD    981 - 1050
RLLGIKTETPSTVSTNASTPQSVSSVVHYLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESL   1051 - 1120
LSSASLSQVFLHLSTLDRSVIWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDW   1121 - 1190
FCPECRPKQRSRRLSSRQRPSLESDEDVEDSMGGEDDEVDGDEEEGQSEEEEYEVEQDEDDSQEEEEVSL   1191 - 1260
PKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVSSKTGRSLRKINSAPPTETKSLR   1261 - 1330
IASRSTRHSHGPLQADVFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSVNIASKLSLQ   1331 - 1400
ESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDII   1401 - 1470
KKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPS   1471 - 1540
NVDQVSTPPAAKKSRI                                                         1541 - 1556
//

Text Mined References (31)

PMID Year Title