Property Summary

NCBI Gene PubMed Count 27
PubMed Score 17.61
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 2.100 9.6e-03
astrocytic glioma -2.000 4.2e-02
psoriasis -4.600 2.8e-06
osteosarcoma -1.640 1.4e-04
atypical teratoid / rhabdoid tumor -1.600 3.6e-03
glioblastoma -1.400 3.2e-03
medulloblastoma, large-cell -1.600 6.5e-04
acute quadriplegic myopathy 1.001 8.6e-06
tuberculosis and treatment for 6 months 1.100 4.7e-05
diabetes mellitus 1.900 1.4e-03
adult high grade glioma -1.400 3.5e-02
subependymal giant cell astrocytoma -1.331 3.6e-02
Pick disease 1.400 1.4e-03
ovarian cancer 1.900 2.1e-04

Synonym

Accession Q9UL15 O94950 Q86W59 BAG-5
Symbols BAG-5

Gene

PANTHER Protein Class (1)

PDB

2D9D   3A8Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
25006867 This study showed that BAG2 (Bcl-2 associated athanogene family protein 2) and BAG5 (Bcl-2-associated athanogene family protein 5) stabilise pathogenic ataxin3-80Q by inhibiting its ubiquitination.
24510904 BAG5 is a binding partners of LRRK2 and part of a complex that promotes clearance of Golgi-derived vesicles through the autophagy-lysosome system.
24475098 BAG5 protects against mitochondrial oxidative damage through regulating PINK1 degradation.
23448667 Bag5 is overexpressed in prostate cancer and plays a role in endoplamic reticulum-stress induced apoptosis. Furthermore we have identified GRP78/BiP as a novel interaction partner of Bag5.
21358815 A novel function for BAG5 as a modulator of CHIP E3 ubiquitin ligase activity with implications for CHIP-mediated regulation of alpha-syn oligomerization.
21131737 BAG5 directly interacts with Parkin and stabilizes Parkin via the ubiquitin-mediated proteasomal pathway.
20855536 We replicated the association of BCL2L11 and CASP9 with non-Hodgkin's lymphoma risk at the gene and SNP level, and identified novel associations with BCLAF1 and BAG5.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15603737 Bcl-2-associated athanogene 5 (BAG5) is a negative regulator of both Hsp70 and parkin function that sensitizes dopaminergic neurons to injury-induced death.

AA Sequence

MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR      1 - 70
AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG     71 - 140
GKISLRKARYHTLTKICAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN    141 - 210
ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE    211 - 280
KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE    281 - 350
ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC    351 - 420
KAARKQAVRLAQNILSYLDLKSDEWEY                                               421 - 447
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25006867 2015 The BAG2 and BAG5 proteins inhibit the ubiquitination of pathogenic ataxin3-80Q.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24475098 2014 BAG5 protects against mitochondrial oxidative damage through regulating PINK1 degradation.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23448667 2013 Bcl-2 associated athanogene 5 (Bag5) is overexpressed in prostate cancer and inhibits ER-stress induced apoptosis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21358815 2011 Ubiquitinylation of ?-synuclein by carboxyl terminus Hsp70-interacting protein (CHIP) is regulated by Bcl-2-associated athanogene 5 (BAG5).
21269460 2011 Initial characterization of the human central proteome.
21131737 2010 [Direct interaction between BAG5 protein and Parkin protein].
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20223214 2010 The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15603737 2004 BAG5 inhibits parkin and enhances dopaminergic neuron degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9873016 1999 An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators.
9321400 1997 GrpE-like regulation of the hsc70 chaperone by the anti-apoptotic protein BAG-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7834747 1995 Cloning and functional analysis of BAG-1: a novel Bcl-2-binding protein with anti-cell death activity.