Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPRFASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTP      1 - 70
TWCIVHAAGSQGWVPWKYRVFLRDELCIKQEDSLFSEFCDVVRKAYGKCVIVVKERRQQEEQRPKEDREA     71 - 140
EGQFYIPTVISLASIMCCPEVAKSCGHELLSLPSPCNYLNPLDSAWSSLKWFIINNRNEFCLQSIDSGYS    141 - 210
YQCILFSNLISKGIERINASKWRTLTSKVRRWENYYLGKFS                                 211 - 251
//

Text Mined References (2)

PMID Year Title