Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession B9A014
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MPRFASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTP      1 - 70
TWCIVHAAGSQGWVPWKYRVFLRDELCIKQEDSLFSEFCDVVRKAYGKCVIVVKERRQQEEQRPKEDREA     71 - 140
EGQFYIPTVISLASIMCCPEVAKSCGHELLSLPSPCNYLNPLDSAWSSLKWFIINNRNEFCLQSIDSGYS    141 - 210
YQCILFSNLISKGIERINASKWRTLTSKVRRWENYYLGKFS                                 211 - 251
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
10830953 2000 The DNA sequence of human chromosome 21.