Property Summary

NCBI Gene PubMed Count 1
PubMed Score 3.88
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.5e-46
Disease Target Count Z-score Confidence
Marfan Syndrome 15 4.136 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 8.5e-46

 Compartment GO Term (1)

AA Sequence

MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQ      1 - 70
EELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGL     71 - 140
SLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAA    141 - 210
ERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAP    211 - 280
SGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLR    281 - 350
YARPADAL                                                                  351 - 358
//

Text Mined References (3)

PMID Year Title