Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 11.07

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MTAASRANPYSIVSLEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIAFANMDEKSQRYLAD      1 - 70
MFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEGHGRTPCVMQVHGFMAAFLFSIET     71 - 140
QTTIGYGLRCVTEECLVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLC    141 - 210
LMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPL    211 - 280
FGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYE    281 - 350
VPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG    351 - 420
VLEQRPYRRGSEI                                                             421 - 433
//

Text Mined References (10)

PMID Year Title